powered by:
Protein Alignment CycA and C02B8.1
DIOPT Version :9
Sequence 1: | NP_524030.2 |
Gene: | CycA / 39340 |
FlyBaseID: | FBgn0000404 |
Length: | 491 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001361920.1 |
Gene: | C02B8.1 / 181072 |
WormBaseID: | WBGene00015320 |
Length: | 112 |
Species: | Caenorhabditis elegans |
Alignment Length: | 56 |
Identity: | 13/56 - (23%) |
Similarity: | 22/56 - (39%) |
Gaps: | 9/56 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 421 THKTAKELNTQAMREKYNRDTYKKVAMMESVEMS---------KDDFDQLCEAYNC 467
|....|.|..:...||.:|....|:..|::.:.| ..:|..||:..:|
Worm 11 TGSATKWLREEEKIEKKSRADQLKIKFMQTRDNSDINSIFSEPPSEFSVLCDDDDC 66
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CycA | NP_524030.2 |
Cyclin_N |
206..332 |
CDD:278560 |
|
Cyclin_C |
334..450 |
CDD:281044 |
8/28 (29%) |
C02B8.1 | NP_001361920.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5024 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.