DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycA and cyb-2.1

DIOPT Version :9

Sequence 1:NP_524030.2 Gene:CycA / 39340 FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_502047.1 Gene:cyb-2.1 / 177994 WormBaseID:WBGene00000866 Length:317 Species:Caenorhabditis elegans


Alignment Length:281 Identity:80/281 - (28%)
Similarity:149/281 - (53%) Gaps:20/281 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 PRNDRQRFLEVVQYQMDILEYFRESEKKHRPKPLYMRRQKDISHNMRSILIDWLVEVSEEYKLDT 254
            ||.:.:..|..:....||..|....|||:.....:: ...:::..||.||:|||::|...:.|..
 Worm    18 PRTNLEEVLNCIAMAEDIYNYLVHHEKKYVLDDSFI-NGGNVNSKMRRILVDWLIQVHLRFHLTP 81

  Fly   255 ETLYLSVFYLDRFLSQMAVVRSKLQLVGTAAMYIAAKYEEIYPPEVGEFVFLTDDSYTKAQVLRM 319
            |||:|::|.|||.:.:..|.:::.||:|.||:::|:|:|:||.|::.|:..:||::::|.|::.|
 Worm    82 ETLHLTIFVLDRIIVKNIVSKAEFQLLGVAALFVASKFEDIYLPDILEYEMITDNTFSKKQIMAM 146

  Fly   320 EQVILKILSFDLCTPTAYVFINTYAVLC---DMPEKLKYMTLYISELSLMEGETYLQYLPSLMS- 380
            ||.||..|:|||..|::.||:...:...   |:....|....|:..:|...||  |..|.|:|| 
 Worm   147 EQTILNALNFDLSCPSSLVFLRCISKTLTENDVNPIDKEAFYYVHNISKCLGE--LALLDSVMST 209

  Fly   381 -------SASVALARHILGMEMWTPRL------EEITTYKLEDLKTVVLHLCHTHKTAKELNTQA 432
                   |||:.:..:::.::...|:.      :::...|.:....:.|.....:|..:.....|
 Worm   210 VPRSHVASASMIITLNVITVDGINPKTAASMIRKQLGASKQDIYDAIALLAQVAYKNFRHQKLCA 274

  Fly   433 MREKYNRDTYKKVAMMESVEM 453
            :||||....:.:|:.:.:.|:
 Worm   275 IREKYQSSKFGRVSYLMTDEI 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 48/125 (38%)
Cyclin_C 334..450 CDD:281044 27/132 (20%)
cyb-2.1NP_502047.1 COG5024 <32..300 CDD:227357 77/267 (29%)
Cyclin_N 34..159 CDD:365896 48/125 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 111 1.000 Domainoid score I3909
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 1 1.000 - - FOG0000121
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100199
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X94
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.