DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycA and ccng1

DIOPT Version :9

Sequence 1:NP_524030.2 Gene:CycA / 39340 FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:XP_021336635.1 Gene:ccng1 / 171473 ZFINID:ZDB-GENE-020322-1 Length:313 Species:Danio rerio


Alignment Length:314 Identity:68/314 - (21%)
Similarity:134/314 - (42%) Gaps:62/314 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 TETGVSP-TGRVKELPPRNDRQRFLEVVQYQMDILEYFRESEKKHRPKPLYMRRQKDISHN---- 234
            ||||..| |.::|.|                       .:.|.:::||...:|..:....|    
Zfish    20 TETGALPFTVQLKSL-----------------------LDQESRYQPKLCGLRVIESAQDNGLRM 61

  Fly   235 ---MRSILIDWLVEVSEEYKLDTETLYLSVFYLDRFLSQMAVVRSKLQLVGTAAMYIAAK--YEE 294
               :|...:..|:.::..:....||...:|..|||||:.|.:....|..||....|||.|  .||
Zfish    62 TVKLRDYQVRELLSLTRFFGFCAETFSFAVNLLDRFLAVMKIQPKHLSCVGLCCFYIAVKTSEEE 126

  Fly   295 IYPPEVGEFVFLTDDSYTKAQVLRMEQVILKILSFDLCTPTAYVFINTYAVLCDMPEKLKYMTLY 359
            ...|...:.:.::.:.:|...::|||::||:.|::.:..|||..|:..:.  ..:.||:...:..
Zfish   127 KNVPLASDLIRISQNRFTVHDMMRMEKIILEKLNWKVKAPTALHFLRFFH--SHIQEKVDTESKK 189

  Fly   360 ISELSLMEGE--------TYLQYLPSLMSSASVALA---RH----ILGMEMWTPRLEEITTYKLE 409
            |..:..:|.:        |:.:..|||::.:.:||.   :|    :..::.....|::....|:.
Zfish   190 ILNIERLEAQLKACHCSFTFTKLKPSLLALSLLALEIEDQHEYEPVPSLKEALDGLQQSLNVKVG 254

  Fly   410 DLKTV--VLHLC---HTHKTAKELNTQAMR-------EKYNRDTYKKVAMMESV 451
            ||..|  ::..|   ::....::.|.|.:|       .:..:.:|.|:|.:.::
Zfish   255 DLVCVRELVAKCLVEYSSTKCQKPNGQRLRWMISGRTARQLKHSYYKIAHLPTI 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 33/134 (25%)
Cyclin_C 334..450 CDD:281044 27/142 (19%)
ccng1XP_021336635.1 Cyclin_N 31..163 CDD:306612 35/154 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579794
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.