DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycA and Ccng2

DIOPT Version :9

Sequence 1:NP_524030.2 Gene:CycA / 39340 FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_031661.3 Gene:Ccng2 / 12452 MGIID:1095734 Length:344 Species:Mus musculus


Alignment Length:294 Identity:71/294 - (24%)
Similarity:128/294 - (43%) Gaps:40/294 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 ILEYFRESEKKHRP--KPLYM-----RRQKDISHNMRSILIDWLVEVSEEYKLDTETLYLSVFYL 264
            :|.::.|.|::::|  |.|.:     .....:...:|:..::.|..::..:...|||..|:|..|
Mouse    20 LLNFYLEQEQRYQPREKGLILMEATPENDNTLCSRLRNAKVEDLRSLTNFFGSGTETFVLAVNIL 84

  Fly   265 DRFLSQMAVVRSKLQLVGTAAMYIAAKY--EEIYPPEVGEFVFLTDDSYTKAQVLRMEQVILKIL 327
            ||||:.|.|....|..:|.....:||:.  ||...|...:.:.::....|.:.:.|||::|.:.|
Mouse    85 DRFLALMKVKPKHLSCIGVCCFLLAARLAEEEGDVPPTHDVIRISQCKCTASDIKRMEKIISEKL 149

  Fly   328 SFDLCTPTAYVFINTY--AVLCDMPEKLKYMTLYISELSLMEGE---TYLQYLPSLMSSASVALA 387
            .::|...||..|::.|  .|.|...|:.:.::|...|..|....   .:.:..||:       ||
Mouse   150 HYELEATTALNFLHLYHAIVFCHTSERKEILSLDKLEAQLKACNCRVVFSKARPSV-------LA 207

  Fly   388 RHILGMEMWTPRLEEITTYKLEDLKTVVLHLCHTHKTAKELNTQAMREKYNRDTYKK-VAMMESV 451
            ..:|.:|:.|.:..|:    ||.|..|..||       |..:|:..   |.|:...| :|...|.
Mouse   208 LCLLNLEIETIKSVEL----LEILLLVKKHL-------KLSDTEFF---YWRELVSKCLAEYSSP 258

  Fly   452 EMSKDDFDQLCEAYNCKQKEDEHQQ----PDINT 481
            ...|.|..:|....:.:..::.|..    |::.|
Mouse   259 RCCKPDLKKLVWIVSRRTAQNLHSSYYSVPELPT 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 33/133 (25%)
Cyclin_C 334..450 CDD:281044 30/121 (25%)
Ccng2NP_031661.3 Cyclin_N <74..153 CDD:278560 25/78 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 298..324
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836321
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.