DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycA and Ccng1

DIOPT Version :9

Sequence 1:NP_524030.2 Gene:CycA / 39340 FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_033961.1 Gene:Ccng1 / 12450 MGIID:102890 Length:294 Species:Mus musculus


Alignment Length:235 Identity:58/235 - (24%)
Similarity:110/235 - (46%) Gaps:23/235 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 DRQRFLEVVQYQMDILEYFRESEKKHRPKPLYMRRQKDISHN-------MRSILIDWLVEVSEEY 250
            |.|:.|    :|::.|   .|.|.:.:||...::..:....|       :|...:..|:.:::.:
Mouse     8 DSQKLL----HQLNTL---LEQESRCQPKVCGLKLIESAHDNGLRMTARLRDFEVKDLLSLTQFF 65

  Fly   251 KLDTETLYLSVFYLDRFLSQMAVVRSKLQLVGTAAMYIAAK--YEEIYPPEVGEFVFLTDDSYTK 313
            ..||||..|:|..||||||:|.|....|..||.:..|:|.|  .||...|...:.:.::...:|.
Mouse    66 GFDTETFSLAVNLLDRFLSKMKVQAKHLGCVGLSCFYLAVKATEEERNVPLATDLIRISQYRFTV 130

  Fly   314 AQVLRMEQVILKILSFDLCTPTAYVFINTYAVLCDMPEKLKYMTLYISELSLMEGETYLQYLPSL 378
            :.::|||:::|:.:.:.:...||:.|:..|..|  :.:.|.:..........:|.:....:...:
Mouse   131 SDLMRMEKIVLEKVCWKVKATTAFQFLQLYYSL--VHDTLPFERRNDLNFERLEAQLKACHCRII 193

  Fly   379 MSSASVA-LARHILGMEMWTPRLEEITTYKLEDLKTVVLH 417
            .|.|..: ||..||.:|:...:..|:|    |.::.:..|
Mouse   194 FSKAKPSVLALSILALEIQALKYVELT----EGVECIQKH 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 36/134 (27%)
Cyclin_C 334..450 CDD:281044 18/85 (21%)
Ccng1NP_033961.1 Cyclin_N 16..148 CDD:278560 36/134 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836320
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.