DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycA and LOC105948062

DIOPT Version :9

Sequence 1:NP_524030.2 Gene:CycA / 39340 FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:XP_012824176.1 Gene:LOC105948062 / 105948062 -ID:- Length:301 Species:Xenopus tropicalis


Alignment Length:246 Identity:59/246 - (23%)
Similarity:109/246 - (44%) Gaps:18/246 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 PTGRVKELPPRNDRQRFLEVVQYQMDILE---YFRESEKKHRPKPLYMRRQKDISHNMRSILIDW 242
            |.|.|....|.|...:..|.::...:..|   .|.:|:::......::.:|.:||....|.:...
 Frog    40 PRGPVYLKDPWNSFGKIGEALKMFSEFGENGYQFNKSKEESFTPVNFLDKQPNISETSWSAVTTQ 104

  Fly   243 LVEVSEEYKLDTETLYLSVFYLDRFLSQMAVVRSKLQLVGTAAMYIAAKYEEIYPPEVGEFV-FL 306
            ::.|..:|..|.|||.||:..|.|:|....:..:.|:.||...:|:|.|..|.:.|:..:|: ..
 Frog   105 MINVHRKYGFDFETLCLSINMLQRYLDCTPIEIAILKAVGATCLYVACKVVEKHHPKKRKFLKAF 169

  Fly   307 TDDSYTKAQVLRMEQVILKILSFDLCTPTAYVFINTYAV--LCDMPEKLKYMTLYISELSLMEGE 369
            |:...|...:..:|::|||.|...|..||...|:..|::  :........::|..:..|...:..
 Frog   170 TNTGLTPTLLYGLEKLILKKLHCRLWAPTINSFLEYYSLQRMSRNKNSHAHLTREVKTLLAAKAV 234

  Fly   370 TYLQ--------YLPSLMSSASVALARHIL--GMEMWTP--RLEEITTYKL 408
            ..|.        :.||:|:.:.:..|..::  |:|...|  .||:...|:|
 Frog   235 AALSMTSYKAQAHKPSIMAQSCLKAADLLMQEGIEKAAPLTSLEKGFLYQL 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 34/129 (26%)
Cyclin_C 334..450 CDD:281044 18/89 (20%)
LOC105948062XP_012824176.1 CYCLIN_SF 105..190 CDD:424085 26/84 (31%)
CYCLIN_SF 197..>266 CDD:424085 11/68 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.