DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycA and LOC105946681

DIOPT Version :9

Sequence 1:NP_524030.2 Gene:CycA / 39340 FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:XP_012813701.1 Gene:LOC105946681 / 105946681 -ID:- Length:437 Species:Xenopus tropicalis


Alignment Length:232 Identity:61/232 - (26%)
Similarity:104/232 - (44%) Gaps:22/232 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 QYQMDILEYFRESEKKHRPKPLYMRRQKDISHNMRSILIDWLVEVSEEYKLDTETLYLSVFYLDR 266
            :|..|...:.:..||...|.. ::..|.::.......:.:.|::|...:.||..||.|||.||.|
 Frog   105 EYGEDAYLFNKRLEKDFSPLD-FLANQHEVDPTNWEEVTNILIKVHRHFSLDFSTLCLSVNYLAR 168

  Fly   267 FLSQMAVVRSKLQLVGTAAMYIAAKYEEIYPPEVGEFVFLTDD-SYTKAQVLRMEQVILKILSFD 330
            ::||..:..:.|:.:|...:|:|.|......|...:|:.|..| :||.|.:..:|:.::..|.:.
 Frog   169 YISQRPLKATILKPLGATCLYLATKIMGRKRPSAEDFLELFGDANYTPAYIAYVEKNLMCQLDYR 233

  Fly   331 LCTPTAYVFINTYAVLCDMPEKLK-YMTLYISELSLMEGETYL--------QYLPSLMSSASVAL 386
            |..||...|:..::::....||.. .:|...:.|:...|...|        ||.|||::...:..
 Frog   234 LQGPTIDFFLEHFSLIRASSEKCSGIITRAANALTAARGIAALAMTQYGFHQYAPSLLAQCCLKA 298

  Fly   387 ARHILGMEMWTPRLEEITTYK-------LEDLKTVVL 416
            |.:|.|..  |...||...|.       ||  ||::|
 Frog   299 ADNIFGYN--TANEEEPRDYPAHLMQECLE--KTLLL 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 33/126 (26%)
Cyclin_C 334..450 CDD:281044 26/99 (26%)
LOC105946681XP_012813701.1 U2AF_lg 7..>73 CDD:273727
Cyclin_N 109..234 CDD:365896 33/125 (26%)
Cyclin_C 237..>310 CDD:367282 18/74 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.