DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycA and CCNO

DIOPT Version :9

Sequence 1:NP_524030.2 Gene:CycA / 39340 FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_066970.3 Gene:CCNO / 10309 HGNCID:18576 Length:350 Species:Homo sapiens


Alignment Length:281 Identity:78/281 - (27%)
Similarity:128/281 - (45%) Gaps:30/281 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 PMSVDRSILGVIQS-SDISVGTET-----GVSPTGRVKELPPRNDRQRFLEVVQ--YQMDILEYF 211
            |:..|..|..:.:| |..|.|.|:     |.||.....:...:.|.|.|.:..|  |.      |
Human    50 PLPGDSGICDLFESPSSGSDGAESPSAARGGSPLPGPAQPVAQLDLQTFRDYGQSCYA------F 108

  Fly   212 RESEKKHRPKPLYMRRQKDISHNMRSILIDWLVEVSEEYKLDTETLYLSVFYLDRFLSQMAVVRS 276
            |::::.|......:.||..::...|..|:.||:.|..::.|..|:|.|:|..|||||:...|...
Human   109 RKAQESHFHPREALARQPQVTAESRCKLLSWLIPVHRQFGLSFESLCLTVNTLDRFLTTTPVAAD 173

  Fly   277 KLQLVGTAAMYIAAKYEEIYPPEVGEFVFLTDDSYTKAQVLRMEQVILKILSFDLCTPTAYVFIN 341
            ..||:|..::.||.|..|::||.|.:.:.|...::::.|:..:|.::|..|.|.|..||...|:.
Human   174 CFQLLGVTSLLIACKQVEVHPPRVKQLLALCCGAFSRQQLCNLECIVLHKLHFTLGAPTISFFLE 238

  Fly   342 TY------AVLCDMPEKLKYMTLY--ISELSLMEGETYLQYLPSLMSSASVALARHILGMEMWTP 398
            .:      |...:..|.|:...|.  ::||||.: ..:..|.|||::...:|||..:|       
Human   239 HFTHARVEAGQAEASEALEAQALARGVAELSLAD-YAFTSYSPSLLAICCLALADRML------- 295

  Fly   399 RLEEITTYKLEDLKTVVLHLC 419
            |:......:|.|.....|..|
Human   296 RVSRPVDLRLGDHPEAALEDC 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 37/125 (30%)
Cyclin_C 334..450 CDD:281044 24/94 (26%)
CCNONP_066970.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..89 11/38 (29%)
Cyclin_N 108..229 CDD:278560 37/120 (31%)
Cyclin_C 231..>296 CDD:281044 19/72 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.