DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycA and LOC100493210

DIOPT Version :9

Sequence 1:NP_524030.2 Gene:CycA / 39340 FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:XP_002945604.1 Gene:LOC100493210 / 100493210 -ID:- Length:311 Species:Xenopus tropicalis


Alignment Length:217 Identity:56/217 - (25%)
Similarity:93/217 - (42%) Gaps:23/217 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 PRND-----------RQRFLEVVQYQMDILEYFRESEKKHRPKPLYMRRQKDISHNMRSILIDWL 243
            |||:           .|.|.|   |..|...|.|..|:|..... :::.|.:|:..........|
 Frog    51 PRNEPWHTLAHMGNALQTFKE---YGKDSYLYSRGLEEKFMAVN-FLQHQPEITSASWYEFTSRL 111

  Fly   244 VEVSEEYKLDTETLYLSVFYLDRFLSQMAVVR-SKLQLVGTAAMYIAAKYEEIYPPEVGEFVFLT 307
            :.:....:||..:|.|:...|:|||:....:: :.|..||.....||.|..|.......:...|.
 Frog   112 ICIHRHLRLDFRSLCLTANLLERFLACADPIKTTDLNRVGATCFNIACKLAEKRNQRRPKHQKLF 176

  Fly   308 DDSYTKAQVLRMEQVILKILSFDLCTPTAYVFINTYAVL-----CDMPEKLKYMTLY--ISELSL 365
            ||:.|..::.|:|:.|::.|.|.|..||...|:..:.:|     .|.|:....:|..  |:.|||
 Frog   177 DDTLTLKEMSRLERNIIRKLKFRLEAPTMDYFMEHFTLLRVASQKDSPKAAIALTAARGIAALSL 241

  Fly   366 MEGETYLQYLPSLMSSASVALA 387
            ...:.:..|.||:|:...:.:|
 Frog   242 THHQDFYTYAPSVMALCCLKVA 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 32/126 (25%)
Cyclin_C 334..450 CDD:281044 16/61 (26%)
LOC100493210XP_002945604.1 Cyclin_N 75..200 CDD:365896 32/125 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.