DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycA and XB940382

DIOPT Version :9

Sequence 1:NP_524030.2 Gene:CycA / 39340 FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:XP_002943185.2 Gene:XB940382 / 100492352 XenbaseID:XB-GENE-940383 Length:436 Species:Xenopus tropicalis


Alignment Length:267 Identity:68/267 - (25%)
Similarity:116/267 - (43%) Gaps:27/267 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 GTETGVSPTGR--VKELPPRNDRQRFLEVVQ----YQMDILEYFRESEKKHRPKPLYMRRQKDIS 232
            ||.|   ||..  |.|..|.|......:.:|    |..:...|.:..|..::.:. ::..||:|:
 Frog    41 GTST---PTAEEPVPEGEPWNTLTNLADALQTFREYGEECYLYKKGLEGDYQMEN-FLENQKEIN 101

  Fly   233 HNMRSILIDWLVEVSEEYKLDTETLYLSVFYLDRFLSQMAVVRSKLQLVGTAAMYIAAKYEEI-Y 296
            ....:.:...::.|....:||.:||.|.:.:|:|::|........|..||...:|:|.|..|: |
 Frog   102 PTSWNYITTLMINVHRYLRLDFQTLCLGINFLERYVSCTPTDPDTLTRVGATCLYMAYKVAELRY 166

  Fly   297 PPEVGEFVFLTDDSYTKAQVLRMEQVILKILSFDLCTPTAYVFINTYAVL-------CDMPEKL- 353
            |.....|:.|.|...|.|::..:|:.||:.|.|.|..||...|:..:::|       |. |.:| 
 Frog   167 PLPPKHFLPLFDYRMTPAEMRHLERTILRKLLFRLGVPTIDFFLEHFSLLRLTNQEECS-PAQLT 230

  Fly   354 ---KYMTLY--ISELSLMEGETYLQYLPSLMSSASVALARHILGMEMWTPRLEEITTYKLEDLKT 413
               |.:|..  |:.|.|.:...:..:.||||:...:.:|..|....  .|.....|.|....::.
 Frog   231 RAAKSLTAARGIAALCLNQHHDFYMHKPSLMALCCLNVADKIYCYN--NPVKVAPTDYPEHQIEE 293

  Fly   414 VVLHLCH 420
            .:..:||
 Frog   294 CIEKICH 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 33/126 (26%)
Cyclin_C 334..450 CDD:281044 23/100 (23%)
XB940382XP_002943185.2 COG5024 <92..336 CDD:227357 55/213 (26%)
Cyclin_N 92..202 CDD:365896 31/110 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.