DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycA and XB997834

DIOPT Version :9

Sequence 1:NP_524030.2 Gene:CycA / 39340 FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:XP_017951851.1 Gene:XB997834 / 100487861 XenbaseID:XB-GENE-997835 Length:327 Species:Xenopus tropicalis


Alignment Length:238 Identity:60/238 - (25%)
Similarity:110/238 - (46%) Gaps:21/238 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 SPTGRVKELPPRNDRQRFLEVVQYQMDILE---YFRESEKKHRPKPLYMRRQKDISHNMRSILID 241
            ||...|::  |.|......:.:|..||..|   .|::|.::......::..|.||:......::.
 Frog    36 SPAPPVQD--PWNTFGNMADTLQTFMDYGETCYMFKKSLEEDFIPHNFLANQSDINAKCWKDVVI 98

  Fly   242 WLVEVSEEYKLDTETLYLSVFYLDRFLSQMAVVRSKLQLVGTAAMYIAAKYEEIYPPEVGEFVFL 306
            .::.....:|||.|||.|:|.||:|||:...:..:.|:::|...:|:|.|..|...|::.:|:.|
 Frog    99 TMIIAHRAFKLDFETLCLAVNYLERFLACTPLKAANLKVMGGTCLYLACKVMEKSLPKINQFLAL 163

  Fly   307 -TDDSYTKAQVLRMEQVILKILSFDLCTPTAYVFINTYAV---------LCDMPEKLKYMTLY-- 359
             .:|.:|...:..:|:::|:.|.|.|..||...|:..:::         ...:......:|..  
 Frog   164 FCEDGFTAPLMSYLERLVLRRLCFRLGAPTIEYFLEHFSLRRVSNKECPAAKINRAANALTAARG 228

  Fly   360 ISELSLMEGETYLQYLPSLMSSASVALARHILGMEMWT---PR 399
            |:.|| |....:..|.|||::...:..|..|...:.|.   ||
 Frog   229 IAALS-MTKYGFPAYPPSLLAQCCLTAADQIFQYDPWNRVHPR 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 35/129 (27%)
Cyclin_C 334..450 CDD:281044 17/80 (21%)
XB997834XP_017951851.1 Cyclin_N 66..190 CDD:365896 33/123 (27%)
Cyclin_C 192..>268 CDD:367282 15/76 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.