DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycA and LOC100364016

DIOPT Version :9

Sequence 1:NP_524030.2 Gene:CycA / 39340 FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:XP_008756873.2 Gene:LOC100364016 / 100364016 RGDID:2321841 Length:366 Species:Rattus norvegicus


Alignment Length:245 Identity:81/245 - (33%)
Similarity:140/245 - (57%) Gaps:14/245 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 YQMDILEYFRESEKKHRPKPLYMRRQKDISHNMRSILIDWLVEVSEEYKLDTETLYLSVFYLDRF 267
            |..||.:|.|:.|......|.:: ..:||:..||:||:||||:|..:::|..||||:.:..:|||
  Rat   134 YVKDIYQYLRQLEALQSINPHFL-DGRDINGRMRAILVDWLVQVHSKFRLLQETLYMCIAIMDRF 197

  Fly   268 LSQMAVVRSKLQLVGTAAMYIAAKYEEIYPPEVGEFVFLTDDSYTKAQVLRMEQVILKILSFDLC 332
            |....|.|.||||||..|:.:|:||||::.|.:.:||::||::||.:|:..||.:|||.|.|:|.
  Rat   198 LQAQPVCRKKLQLVGITALLLASKYEEMFSPNIEDFVYITDNAYTSSQIREMETLILKELKFELG 262

  Fly   333 TPTAYVFINTYAVLCDMPEKLKYMTLYISELSLMEGETYLQYLPSLMSSASVALARHILGMEMWT 397
            .|....|:...:...::..:...:..|:.||:|::.: .:.|.||.:::|:..|::.:||...|.
  Rat   263 RPLPLHFLRRASKAGEVDVEQHTLAKYLMELTLVDYD-MVHYHPSQVAAAASCLSQKVLGQGKWN 326

  Fly   398 PRLEEITTYKLEDLKTVVLHLCHTHKTAKELNTQAMREKYNRDTYKKVAM 447
            .:.:..|.|...::..|:.|:      ||.:      .|.|.:..|.:|:
  Rat   327 LKQQYYTGYMESEILEVMQHM------AKNV------VKVNENLTKFIAV 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 55/125 (44%)
Cyclin_C 334..450 CDD:281044 24/114 (21%)
LOC100364016XP_008756873.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.