DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycA and ccni2

DIOPT Version :9

Sequence 1:NP_524030.2 Gene:CycA / 39340 FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:XP_003200952.1 Gene:ccni2 / 100330479 ZFINID:ZDB-GENE-081106-2 Length:310 Species:Danio rerio


Alignment Length:259 Identity:58/259 - (22%)
Similarity:101/259 - (38%) Gaps:69/259 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 DISHNMRSILIDWLVEVSEEYKLDTETLYLSVFYLDRFLSQMAVVRSKLQLVGTAAMYIAAKYEE 294
            |||.:....:|.||.|::..::..||||.|.|..|:..|:.:......|:.:...::.:|||.. 
Zfish    41 DISPSQYHEVILWLREMNVIFQFSTETLALGVCVLNSLLATVKTQLKYLKCMAITSLILAAKIN- 104

  Fly   295 IYPPEVGEFVFLTDD-------SYTKAQVLRMEQVILKILSFDLCTPTAYVFINTYAVLCDMPEK 352
                |..|.:....|       .::.|::||||:|||..|.::|...|...||:.:..|      
Zfish   105 ----EEDEVIASVKDLLEQSRCKFSTAEILRMERVILHKLHWEL
YLATPMDFIHIFHGL------ 159

  Fly   353 LKYMTLYISELSLMEGETYLQYLPSLMSSASVALARHILGMEMWTPRLEE-ITTYKLEDLKTVVL 416
                        ||.|            .......|..|...:|:.:|:. :..::|...|..:|
Zfish   160 ------------LMSG------------CVDQTQKRLCLQAALWSRQLQHCMACHQLWQFKGSIL 200

  Fly   417 HLCHTHKTAKELNTQAMREKYNRDTYK------KVAMMESVEMSKDDFDQLCEAYNCKQKEDEH 474
            .|.        :.|..: |:...|.:.      :.|.:||.|:       :|    |::..||:
Zfish   201 ALA--------IITLEL-ERLTPDWFSVFTGLLRKAQIESTEL-------IC----CRETVDEY 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 31/108 (29%)
Cyclin_C 334..450 CDD:281044 19/122 (16%)
ccni2XP_003200952.1 Cyclin_N 36..144 CDD:278560 31/107 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579797
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.