DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycA and ccni2

DIOPT Version :9

Sequence 1:NP_524030.2 Gene:CycA / 39340 FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001096463.1 Gene:ccni2 / 100125081 XenbaseID:XB-GENE-5874358 Length:358 Species:Xenopus tropicalis


Alignment Length:219 Identity:58/219 - (26%)
Similarity:102/219 - (46%) Gaps:29/219 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 DIS--HNMRSILIDWLVEVSEEYKLDTETLYLSVFYLDRFLSQMAVVRSKLQLVGTAAMYIAAK- 291
            |||  |..::||  |:.||:..::...||..|:|..|:|.|:.:.|....|:.:....:::||| 
 Frog    41 DISLTHYEQAIL--WIDEVTLRFRFYPETFGLAVSILNRILASVKVQVKYLRCITVTCLFLAAKT 103

  Fly   292 -YEEIYPPEVGEFVFLTDDSYTKAQVLRMEQVILKILSFDLCTPTAYVFINTY--AVLCDMPEKL 353
             .|:...|.|......:....:.|::||||:::|..|.:||||.|...|:||:  .::.::|...
 Frog   104 NEEDEIIPSVKRLAVQSGCMCSPAEILRMERIVLDKLQWDLCTATPVDFLNTFHAMLMSNLPHLF 168

  Fly   354 ---------KYMTLYISEL-SLMEGETYLQYLPSLMSSASVALARHILGMEMWTPRLEE-ITTYK 407
                     .::.|...:| ..|.....:|:..|.::...:.|....|..: |.|.:.| :...|
 Frog   169 HDCLRMNPSSHLALLTRQLQQCMACHQLVQFRGSTLALVIITLELEKLTAD-WFPAITELLKKAK 232

  Fly   408 LEDLKTVVLHLCHTHKTAKELNTQ 431
            ::..|.:   ||      |||..|
 Frog   233 VDSAKFI---LC------KELVDQ 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 32/105 (30%)
Cyclin_C 334..450 CDD:281044 23/111 (21%)
ccni2NP_001096463.1 Cyclin_N 44..145 CDD:278560 29/102 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.