DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL10Ab and Mrpl1

DIOPT Version :9

Sequence 1:NP_648514.1 Gene:RpL10Ab / 39338 FlyBaseID:FBgn0036213 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_444388.2 Gene:Mrpl1 / 94061 MGIID:2137202 Length:336 Species:Mus musculus


Alignment Length:271 Identity:59/271 - (21%)
Similarity:92/271 - (33%) Gaps:95/271 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASKVSRDTLYE-GVNGLL-------------------EASAKKKRGFLETVELQIGLKNY---- 41
            |||:.|   ||. .||.||                   :..||:|....:.|:....:|:|    
Mouse    23 MASQAS---LYPCSVNSLLHNRHFAAAAAAATKPARKIKKGAKEKTSDEKPVDDIEKIKSYTYME 84

  Fly    42 -DPQKD--------KRFSGTVKLKHI---------PRPKMKVCI-------LGDQQ--------- 72
             ||:.|        :|.....|..|:         ..||..|.:       ||.::         
Mouse    85 SDPEDDVYLKRLYPRRIYEVEKAIHLLKKFQVLDFTNPKQGVYLDLTLDMALGKKKTVEPFASVI 149

  Fly    73 ---HCDEAKANNVDFMDAEALKKLNKNKKLVKKLAKSYDAFLASESLIKQI-------------P 121
               |...::.|.|....|.|.:        :|...::..||.....|:|:|             |
Mouse   150 ALPHLFSSEVNKVAVFTANASE--------IKIAEENGAAFAGGTDLVKKIMDDEVVVDFYVAVP 206

  Fly   122 RLLGPGLNKAGK-----FPALLSHQESM-IGKIEEVKST---IKFQMKKVLCLSVAVGHVGMKSD 177
            .::|. ||...|     ||....:.... |.|:.|:..|   |....::...||..:..:.|.||
Mouse   207 EIMGE-LNPLRKKLKKRFPKATRNSIGRDIPKMLELFKTAHEIMVDEERQNFLSTKIATLDMPSD 270

  Fly   178 ELAQNVNLSIN 188
            ::|.|:...||
Mouse   271 QIAANLQAVIN 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL10AbNP_648514.1 Ribosomal_L1 3..217 CDD:412308 57/269 (21%)
Mrpl1NP_444388.2 Ribosomal_L1 102..244 CDD:381945 28/150 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0081
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.