DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL10Ab and CIC1

DIOPT Version :9

Sequence 1:NP_648514.1 Gene:RpL10Ab / 39338 FlyBaseID:FBgn0036213 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_011919.1 Gene:CIC1 / 856449 SGDID:S000001094 Length:376 Species:Saccharomyces cerevisiae


Alignment Length:274 Identity:61/274 - (22%)
Similarity:120/274 - (43%) Gaps:68/274 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ASKVSRDTLYEGVNGLLEASAKK-----------KRGFLETVE------LQIGLKNYDPQKDKRF 49
            ::.:.|:.:.:.||.|::.::|.           |:..||..|      ||:.:.|     :|.|
Yeast    29 STAIPRERVIKAVNELIKFTSKPQDENNEEGNNGKKNLLEDDEEELKKDLQLIVVN-----NKSF 88

  Fly    50 SGTVK--------LKHIPRPKMK------------VCILGDQQHCDEAKANNVDFMDAEALKK-- 92
            :||.|        :||......|            :.||.|......::.:..|.:|:|.:|.  
Yeast    89 TGTSKSFKLKLLNVKHSFYKPWKEASATAVKDFKVLLILKDSDIKKVSEDDLFDQLDSEGIKVDE 153

  Fly    93 --LNKNKKLVKKLAKSYDAF-------LASESLIKQIPRLL-GPGLNKAGKFP-ALLSHQE---- 142
              ..|:.|.|.|..::.:||       ||.:|::..:|:|: |...||....| ::.:|..    
Yeast   154 IICGKDLKTVYKAYEARNAFISQFSLILADDSIVTSLPKLMGGKAYNKVETTPISIRTHANKEFS 218

  Fly   143 --SMIGKIEEV-KSTIKFQMKKVLCLSVAVGHV-GMKSDELAQNVNLSINFLVSLLKKNWQNVRS 203
              ::...|::| .:.:..::.:...|:|.:|:: .::.:|...||.|....|:    |.:| :||
Yeast   219 LTTLTNNIKKVYMNQLPVKLPRGTTLNVHLGNLEWLRPEEFVDNVELISEQLI----KAYQ-IRS 278

  Fly   204 LHVKSSMGPPQRLY 217
            :.:|::..|...||
Yeast   279 IFIKTNRSPVLPLY 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL10AbNP_648514.1 Ribosomal_L1 3..217 CDD:412308 59/271 (22%)
CIC1NP_011919.1 Ribosomal_L1 77..287 CDD:395558 49/219 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.