DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL10Ab and RPL1A

DIOPT Version :9

Sequence 1:NP_648514.1 Gene:RpL10Ab / 39338 FlyBaseID:FBgn0036213 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_015104.1 Gene:RPL1A / 855881 SGDID:S000006141 Length:217 Species:Saccharomyces cerevisiae


Alignment Length:216 Identity:136/216 - (62%)
Similarity:168/216 - (77%) Gaps:1/216 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SKVSRDTLYEGVNGLLEASAK-KKRGFLETVELQIGLKNYDPQKDKRFSGTVKLKHIPRPKMKVC 66
            ||::...:.|.|..||:.|.: |||.||||||||:||||||||:||||||::||.:.|||.|.:|
Yeast     2 SKITSSQVREHVKELLKYSNETKKRNFLETVELQVGLKNYDPQRDKRFSGSLKLPNCPRPNMSIC 66

  Fly    67 ILGDQQHCDEAKANNVDFMDAEALKKLNKNKKLVKKLAKSYDAFLASESLIKQIPRLLGPGLNKA 131
            |.||....|.||:..||.|..:.||||||||||:|||:|.|:||:|||.||||:||||||.|:||
Yeast    67 IFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLIKKLSKKYNAFIASEVLIKQVPRLLGPQLSKA 131

  Fly   132 GKFPALLSHQESMIGKIEEVKSTIKFQMKKVLCLSVAVGHVGMKSDELAQNVNLSINFLVSLLKK 196
            ||||..:||.:.:.||:.:|:||||||:||||||:||||:|.|:.|.|...:.:|:||.||||||
Yeast   132 GKFPTPVSHNDDLYGKVTDVRSTIKFQLKKVLCLAVAVGNVEMEEDVLVNQILMSVNFFVSLLKK 196

  Fly   197 NWQNVRSLHVKSSMGPPQRLY 217
            |||||.||.|||||||..|||
Yeast   197 NWQNVGSLVVKSSMGPAFRLY 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL10AbNP_648514.1 Ribosomal_L1 3..217 CDD:412308 134/214 (63%)
RPL1ANP_015104.1 Ribosomal_L1 1..217 CDD:412308 134/214 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 259 1.000 Domainoid score I314
eggNOG 1 0.900 - - E1_COG0081
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68543
Inparanoid 1 1.050 269 1.000 Inparanoid score I607
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62172
OrthoFinder 1 1.000 - - FOG0001990
OrthoInspector 1 1.000 - - mtm9189
orthoMCL 1 0.900 - - OOG6_100869
Panther 1 1.100 - - LDO PTHR23105
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1114
SonicParanoid 1 1.000 - - X1303
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.