DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL10Ab and UTP30

DIOPT Version :9

Sequence 1:NP_648514.1 Gene:RpL10Ab / 39338 FlyBaseID:FBgn0036213 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_012986.1 Gene:UTP30 / 853934 SGDID:S000001768 Length:274 Species:Saccharomyces cerevisiae


Alignment Length:160 Identity:37/160 - (23%)
Similarity:71/160 - (44%) Gaps:28/160 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 DFMDAEALKKLNKNKKLVKKLAKSYDAFLASESLIKQIPRLLGPGL-NKAGKFPALLS------- 139
            :.:..:.|::..|..||. :|.|.:|..:|...:...:|.:||... :.:.|.|.::.       
Yeast    99 EIISVKNLRRRFKGSKLT-QLYKDFDLVVADYRVHHLLPEVLGSRFYHGSKKLPYMIRMSKEVKL 162

  Fly   140 HQESMIGKIEEVKSTIKFQMKKVL-----------CLSVAVGHVGMKS-DELAQNVNLSINFLVS 192
            .::.|:.|.:.:  .::.|::.:.           ||||.||::...| .|:.||:..:||||..
Yeast   163 KRQQMVEKCDPI--YVRAQLRSICKNTSYIPNNDNCLSVRVGYIQKHSIPEILQNIQDTINFLTD 225

  Fly   193 LLKKNWQNV-----RSLHVKSSMGPPQRLY 217
            ..|:....|     .|:.||:|......:|
Yeast   226 KSKRPQGGVIKGGIISIFVKTSNSTSLPIY 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL10AbNP_648514.1 Ribosomal_L1 3..217 CDD:412308 36/158 (23%)
UTP30NP_012986.1 Ribosomal_L1 31..249 CDD:395558 36/152 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.