DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL10Ab and PGY1

DIOPT Version :9

Sequence 1:NP_648514.1 Gene:RpL10Ab / 39338 FlyBaseID:FBgn0036213 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_565654.1 Gene:PGY1 / 817299 AraportID:AT2G27530 Length:216 Species:Arabidopsis thaliana


Alignment Length:215 Identity:149/215 - (69%)
Similarity:181/215 - (84%) Gaps:0/215 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SKVSRDTLYEGVNGLLEASAKKKRGFLETVELQIGLKNYDPQKDKRFSGTVKLKHIPRPKMKVCI 67
            ||:..:.:.|.:..:...|.:|||.|:||||||||||||||||||||||:|||.||||||||:|:
plant     2 SKLQSEAVREAITTIKGKSEEKKRNFVETVELQIGLKNYDPQKDKRFSGSVKLPHIPRPKMKICM 66

  Fly    68 LGDQQHCDEAKANNVDFMDAEALKKLNKNKKLVKKLAKSYDAFLASESLIKQIPRLLGPGLNKAG 132
            |||.||.:||:...:..||.||||||||||||||||||||.|||||||:||||||||||||||||
plant    67 LGDAQHVEEAEKMGLSNMDVEALKKLNKNKKLVKKLAKSYHAFLASESVIKQIPRLLGPGLNKAG 131

  Fly   133 KFPALLSHQESMIGKIEEVKSTIKFQMKKVLCLSVAVGHVGMKSDELAQNVNLSINFLVSLLKKN 197
            |||.|:|||||:..|:.|.|:|:|||:|||||:.||||::.|:..:|.|||.:|:||||||||||
plant   132 KFPTLVSHQESLEAKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQLFQNVQMSVNFLVSLLKKN 196

  Fly   198 WQNVRSLHVKSSMGPPQRLY 217
            |||||.|::||:||||||::
plant   197 WQNVRCLYLKSTMGPPQRIF 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL10AbNP_648514.1 Ribosomal_L1 3..217 CDD:412308 149/213 (70%)
PGY1NP_565654.1 Ribosomal_L1 1..216 CDD:412308 149/213 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 294 1.000 Domainoid score I353
eggNOG 1 0.900 - - E1_COG0081
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68543
Inparanoid 1 1.050 309 1.000 Inparanoid score I743
OMA 1 1.010 - - QHG62172
OrthoDB 1 1.010 - - D1172076at2759
OrthoFinder 1 1.000 - - FOG0001990
OrthoInspector 1 1.000 - - otm3379
orthoMCL 1 0.900 - - OOG6_100869
Panther 1 1.100 - - LDO PTHR23105
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1303
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.