DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL10Ab and Rpl10a

DIOPT Version :9

Sequence 1:NP_648514.1 Gene:RpL10Ab / 39338 FlyBaseID:FBgn0036213 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_112327.1 Gene:Rpl10a / 81729 RGDID:620497 Length:217 Species:Rattus norvegicus


Alignment Length:217 Identity:167/217 - (76%)
Similarity:192/217 - (88%) Gaps:0/217 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASKVSRDTLYEGVNGLLEASAKKKRGFLETVELQIGLKNYDPQKDKRFSGTVKLKHIPRPKMKV 65
            |:||||||||||.|..:|..:.:|:|.|||||||||.||||||||||||||||:||..||||..|
  Rat     1 MSSKVSRDTLYEAVREVLHGNQRKRRKFLETVELQISLKNYDPQKDKRFSGTVRLKSTPRPKFSV 65

  Fly    66 CILGDQQHCDEAKANNVDFMDAEALKKLNKNKKLVKKLAKSYDAFLASESLIKQIPRLLGPGLNK 130
            |:||||||||||||.::..||.||||||||||||||||||.||||||||||||||||:|||||||
  Rat    66 CVLGDQQHCDEAKAVDIPHMDIEALKKLNKNKKLVKKLAKKYDAFLASESLIKQIPRILGPGLNK 130

  Fly   131 AGKFPALLSHQESMIGKIEEVKSTIKFQMKKVLCLSVAVGHVGMKSDELAQNVNLSINFLVSLLK 195
            |||||:||:|.|:|:.|::||||||||||||||||:||||||.|..|||..|::|::||||||||
  Rat   131 AGKFPSLLTHNENMVAKVDEVKSTIKFQMKKVLCLAVAVGHVKMTDDELVYNIHLAVNFLVSLLK 195

  Fly   196 KNWQNVRSLHVKSSMGPPQRLY 217
            |||||||:|::||:||.|||||
  Rat   196 KNWQNVRALYIKSTMGKPQRLY 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL10AbNP_648514.1 Ribosomal_L1 3..217 CDD:412308 164/213 (77%)
Rpl10aNP_112327.1 Ribosomal_L1 2..217 CDD:412308 164/214 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354440
Domainoid 1 1.000 307 1.000 Domainoid score I1302
eggNOG 1 0.900 - - E1_COG0081
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68543
Inparanoid 1 1.050 344 1.000 Inparanoid score I2254
OMA 1 1.010 - - QHG62172
OrthoDB 1 1.010 - - D1172076at2759
OrthoFinder 1 1.000 - - FOG0001990
OrthoInspector 1 1.000 - - otm44801
orthoMCL 1 0.900 - - OOG6_100869
Panther 1 1.100 - - LDO PTHR23105
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1303
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.