DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL10Ab and mrpl1

DIOPT Version :9

Sequence 1:NP_648514.1 Gene:RpL10Ab / 39338 FlyBaseID:FBgn0036213 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001016126.1 Gene:mrpl1 / 548880 XenbaseID:XB-GENE-952988 Length:340 Species:Xenopus tropicalis


Alignment Length:231 Identity:41/231 - (17%)
Similarity:77/231 - (33%) Gaps:74/231 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KKKRGFLETVELQ-----------IGLKNYDPQKDKRFSGTVKLKHIPRP----KMKVCILGDQQ 72
            :||..::...||:           .||..::|..|     ....::.|:|    |..:.:|...|
 Frog    61 QKKSRWITKEELEERRKDTSRPKPYGLTAWEPNDD-----VYVARYYPKPLLEVKTAIDMLKTFQ 120

  Fly    73 HCDEAKANNVDFMDAEALKKLNKNKKL---VKKLAKSYD-------------------------- 108
            ..|........:::.:...||.|.||:   |..|...|.                          
 Frog   121 KLDFTYEKQPVYVELKLDMKLEKKKKVDPFVGYLRYPYPFTTDENKVFMFTENPDDAQIAKDNGA 185

  Fly   109 AFLASESLIKQI-------------PRL---LGPGLNK-AGKFPALLSHQESMIGK-----IEEV 151
            ||:.....|:||             |.:   |.|..|| ..|||   ..:...:|:     ::..
 Frog   186 AFVGGSEFIQQILDDEIQADFYIATPEIVPKLTPLKNKLRKKFP---KSKRGSVGRDIPKMLQLF 247

  Fly   152 KSTIKFQMKKVLCLSVAVGHVGMKSDELAQNVNLSI 187
            |:..::.::|...:...:..:.|..:.:..|::..|
 Frog   248 KTGHEYLVEKECLVKTKIATLDMPKEHITANLDALI 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL10AbNP_648514.1 Ribosomal_L1 3..217 CDD:412308 41/231 (18%)
mrpl1NP_001016126.1 Ribosomal_L1 108..250 CDD:381945 27/144 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.