DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL10Ab and NHP2

DIOPT Version :9

Sequence 1:NP_648514.1 Gene:RpL10Ab / 39338 FlyBaseID:FBgn0036213 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001261849.1 Gene:NHP2 / 44005 FlyBaseID:FBgn0029148 Length:160 Species:Drosophila melanogaster


Alignment Length:83 Identity:25/83 - (30%)
Similarity:37/83 - (44%) Gaps:9/83 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 GTVKLKHIPRPKMKVCILGDQQ-HCDEAKANNVDFMDAEAL----KKLNKN-KKLVKKLAKSYDA 109
            |.||::........|...||.. ..:|:..:.:.|::|.|.    |||.|. .||||| |..:..
  Fly     2 GKVKVERSEDADESVVASGDVTIKEEESYDDKLIFVNAIAKPMAGKKLAKKCYKLVKK-AMKHKT 65

  Fly   110 FLASESLIKQIPRLLGPG 127
            ||.:.  :|.:...|..|
  Fly    66 FLRNG--LKDVQTRLRKG 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL10AbNP_648514.1 Ribosomal_L1 3..217 CDD:412308 25/83 (30%)
NHP2NP_001261849.1 Ribosomal_L7Ae 51..146 CDD:396000 12/34 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442658
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23105
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.