DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL10Ab and CG13096

DIOPT Version :9

Sequence 1:NP_648514.1 Gene:RpL10Ab / 39338 FlyBaseID:FBgn0036213 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001285757.1 Gene:CG13096 / 34183 FlyBaseID:FBgn0032050 Length:681 Species:Drosophila melanogaster


Alignment Length:300 Identity:58/300 - (19%)
Similarity:94/300 - (31%) Gaps:118/300 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 NGLLEASAKKKRGFLETVELQIGLKNYDPQKDKRFSGTVKLKHIPRPKMKVC-----ILGDQQHC 74
            |.:.:..||.|:    .|||...||.:|   :|||...|...::    .|||     ::.::.  
  Fly   238 NAVNKEPAKSKK----PVELTFELKAFD---EKRFHEIVNENNV----TKVCAALKSVVSEEV-- 289

  Fly    75 DEAKANNVDFMD---------------AEALKKLNKNKKLV------------------------ 100
             |.|.|...|.|               .:.:.|||....||                        
  Fly   290 -EKKKNTSIFSDYRYVLQVCSYKIPSCPKRMVKLNLKHSLVGKDDDVALIVPDLQRGAKFDYDPT 353

  Fly   101 -----------------------------------KKLAKSYDAFLASESLIKQIPRLLGPGLNK 130
                                               :|...|||..|....|..|....||....|
  Fly   354 KQHYEDMLREAGVKQRLTVVPFNQLRNEMGSFEAKRKFLNSYDYLLCDGRLSGQATAFLGKNTQK 418

  Fly   131 AGKFPALLSH-------QESMIGKIEEVKSTIKF-QMKKVLCLSVAVGHVGMKSDELAQNVNLSI 187
                |..:.|       .:.:..::....:...| |:.|...::|.||:..:.:::||:|:.|.|
  Fly   419 ----PRNVLHSLRLSKDNDKLPQEVTRALTRTAFRQLSKGDLIAVPVGNHEITAEQLAENILLVI 479

  Fly   188 NFLVSLLKKNWQNVRSLHVK-------------SSMGPPQ 214
            ..|..:......|:||:::|             |...||:
  Fly   480 KQLQEVYPGGLANIRSMYLKIDITGTSALPLYVSMCAPPE 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL10AbNP_648514.1 Ribosomal_L1 3..217 CDD:412308 58/299 (19%)
CG13096NP_001285757.1 Ribosomal_L1 285..499 CDD:279077 37/220 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23105
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.