DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL10Ab and rpl-1

DIOPT Version :9

Sequence 1:NP_648514.1 Gene:RpL10Ab / 39338 FlyBaseID:FBgn0036213 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_491061.1 Gene:rpl-1 / 171853 WormBaseID:WBGene00004412 Length:216 Species:Caenorhabditis elegans


Alignment Length:215 Identity:151/215 - (70%)
Similarity:187/215 - (86%) Gaps:0/215 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SKVSRDTLYEGVNGLLEASAKKKRGFLETVELQIGLKNYDPQKDKRFSGTVKLKHIPRPKMKVCI 67
            |||||::|.|.:..:|:.|::|.|.|.||:|||||||||||||||||||:::|||||||.||||:
 Worm     2 SKVSRESLNEAIAEVLKGSSEKPRKFRETIELQIGLKNYDPQKDKRFSGSIRLKHIPRPNMKVCV 66

  Fly    68 LGDQQHCDEAKANNVDFMDAEALKKLNKNKKLVKKLAKSYDAFLASESLIKQIPRLLGPGLNKAG 132
            .|||.|.|||.|.::..|.|:.||||||.|||:||||||||||:|||||||||||:|||||||||
 Worm    67 FGDQHHLDEAAAGDIPSMSADDLKKLNKQKKLIKKLAKSYDAFIASESLIKQIPRILGPGLNKAG 131

  Fly   133 KFPALLSHQESMIGKIEEVKSTIKFQMKKVLCLSVAVGHVGMKSDELAQNVNLSINFLVSLLKKN 197
            |||::::|.||:..|.:|:::|:||||||||||||||||||:..:||..|::|||||||||||||
 Worm   132 KFPSVVTHGESLQSKSDEIRATVKFQMKKVLCLSVAVGHVGLTQEELVSNISLSINFLVSLLKKN 196

  Fly   198 WQNVRSLHVKSSMGPPQRLY 217
            |||||||::||:||.|||:|
 Worm   197 WQNVRSLNIKSTMGKPQRVY 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL10AbNP_648514.1 Ribosomal_L1 3..217 CDD:412308 150/213 (70%)
rpl-1NP_491061.1 Ribosomal_L1 1..216 CDD:294228 150/213 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 290 1.000 Domainoid score I832
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68543
Inparanoid 1 1.050 318 1.000 Inparanoid score I1510
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62172
OrthoDB 1 1.010 - - D1172076at2759
OrthoFinder 1 1.000 - - FOG0001990
OrthoInspector 1 1.000 - - oto19825
orthoMCL 1 0.900 - - OOG6_100869
Panther 1 1.100 - - LDO PTHR23105
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1114
SonicParanoid 1 1.000 - - X1303
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1313.010

Return to query results.
Submit another query.