DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and CanA-14F

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001245717.1 Gene:CanA-14F / 8674098 FlyBaseID:FBgn0267912 Length:584 Species:Drosophila melanogaster


Alignment Length:278 Identity:117/278 - (42%)
Similarity:156/278 - (56%) Gaps:23/278 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LLVGESNLLSLQSPQIVCGDIHGQFEDLLHLLELGGSVQEHRYLFLGDLVDRGKNSVETFLLLAA 107
            ||..|..::.:::|..|||||||||.||:.|.|:|||....:||||||.||||..|:|..|.|.:
  Fly   145 LLRTEKTMIDIEAPVTVCGDIHGQFYDLMKLFEIGGSPATTKYLFLGDYVDRGYFSIECVLYLWS 209

  Fly   108 LKVRHPAQVSLLRGNHECRSATRSYGFYEECLSRYGSANVWRMCCRVFDLLPLAAIIDGNILCVH 172
            ||:.:|..:.|||||||||..|..:.|.:||..:| |..|:..|...||.|||||:::...||||
  Fly   210 LKITYPQTLFLLRGNHECRHLTEYFTFKQECKIKY-SERVYDACMDAFDCLPLAALMNQQFLCVH 273

  Fly   173 GGLSPDMQRLDDLRSLDRCHEIPESGIIADLLWSDPQEAPG--------WAASPRGHGKLFGGDV 229
            |||||::..|:|:|.|||..|.|..|.:.|||||||.|..|        ...|.||....:....
  Fly   274 GGLSPEIHELEDIRRLDRFKEPPAFGPMCDLLWSDPLEDFGNEKNSDFYTHNSVRGCSYFYSYAA 338

  Fly   230 VEEFTRANGISLICRAHQLAQDGFRWH-------FGQLLVTIWSAPNYCYRCGNKAAILRLNAAG 287
            ..:|.:.|.:..|.|||:....|:|.:       |.. |:||:|||||.....||||:|:     
  Fly   339 CCDFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPS-LITIFSAPNYLDVYNNKAAVLK----- 397

  Fly   288 DYDFKVFEAQALHSKPQP 305
             |:..|...:..:..|.|
  Fly   398 -YENNVMNIRQFNCSPHP 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 117/278 (42%)
MPP_superfamily 12..296 CDD:301300 115/267 (43%)
CanA-14FNP_001245717.1 MPP_PP2B 115..419 CDD:277361 117/278 (42%)
PP2Ac 132..403 CDD:197547 114/265 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438867
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.