DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and PPG1

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_014429.3 Gene:PPG1 / 855766 SGDID:S000005315 Length:368 Species:Saccharomyces cerevisiae


Alignment Length:297 Identity:147/297 - (49%)
Similarity:198/297 - (66%) Gaps:15/297 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DADRLVENLRHVPVRLPRELEVRQLCRSLSDLLVGESNLLSLQSPQIVCGDIHGQFEDLLHLLEL 76
            :.|..:|.|....: || |:.||.||..|.::||.|||::.:|:|..|.||:||||.|:|.:.::
Yeast     2 ELDECLERLYKAQL-LP-EVTVRALCFKLKEMLVKESNVIHIQTPVTVVGDMHGQFHDMLEIFQI 64

  Fly    77 GGSVQEHRYLFLGDLVDRGKNSVETFLLLAALKVRHPAQVSLLRGNHECRSATRSYGFYEECLSR 141
            ||.|.:..||||||.||||..||||.:||..||:|:|:::.|||||||.|..|:|||||.|||::
Yeast    65 GGPVPDTNYLFLGDYVDRGLYSVETIMLLIVLKLRYPSRIHLLRGNHESRQITQSYGFYTECLNK 129

  Fly   142 Y-GSANVWRMCCRVFDLLPLAAIIDGNILCVHGGLSPDMQRLDDLRSLDRCHEIPESGIIADLLW 205
            | |::.||:....:||.|.|..|||..|.||||||||::|.:|.::.:||..|||..|.:|||:|
Yeast   130 YGGNSRVWQYLTDIFDYLVLCCIIDDEIFCVHGGLSPNVQTIDQIKIIDRFREIPHDGAMADLVW 194

  Fly   206 SDPQE------------APGWAASPRGHGKLFGGDVVEEFTRANGISLICRAHQLAQDGFRWHFG 258
            |||:|            ...:..||||.|..||..|||:|.|.|.::.|.|||||..:|::.:|.
Yeast   195 SDPEENNNPTLDHPDNSGQHFQVSPRGAGYTFGRSVVEKFLRMNDMNRIYRAHQLCNEGYQIYFD 259

  Fly   259 QLLVTIWSAPNYCYRCGNKAAILRLNAAGDYDFKVFE 295
            .|:.|:||||||||||||||:||.|.:...:.|.|||
Yeast   260 GLVTTVWSAPNYCYRCGNKASILELYSKDQFYFNVFE 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 147/297 (49%)
MPP_superfamily 12..296 CDD:301300 147/297 (49%)
PPG1NP_014429.3 MPP_PP2A_PP4_PP6 2..299 CDD:277360 147/297 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.