DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and PPZ1

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_013696.1 Gene:PPZ1 / 854992 SGDID:S000004478 Length:692 Species:Saccharomyces cerevisiae


Alignment Length:294 Identity:114/294 - (38%)
Similarity:169/294 - (57%) Gaps:9/294 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 EVRQLCRSLSDLLVGESNLLSLQSPQIVCGDIHGQFEDLLHLLELGGSVQEHRYLFLGDLVDRGK 96
            |:.|:|....::.:.:.:||.|..|..:.||:|||:.|||.|....|......||||||.|||||
Yeast   389 EILQICIKAREIFLSQPSLLELSPPVKIVGDVHGQYGDLLRLFTKCGFPPSSNYLFLGDYVDRGK 453

  Fly    97 NSVETFLLLAALKVRHPAQVSLLRGNHECRSATRSYGFYEECLSRYGSANVWRMCCRVFDLLPLA 161
            .|:||.|||...|:::|....||||||||.:.||.||||:|| .|..:..:|:.....|:.||||
Yeast   454 QSLETILLLFCYKIKYPENFFLLRGNHECANVTRVYGFYDEC-KRRCNIKIWKTFIDTFNTLPLA 517

  Fly   162 AIIDGNILCVHGGLSPDMQRLDDLRSLDRCHEIPESGIIADLLWSDPQEAPG-WAASPRGHGKLF 225
            ||:.|.|.||||||||.:..:|::|.:.|..::|:.|:|.|||||||.::|. |..:.||....:
Yeast   518 AIVAGKIFCVHGGLSPVLNSMDEIRHVVRPTDVPDFGLINDLLWSDPTDSPNEWEDNERGVSYCY 582

  Fly   226 GGDVVEEFTRANGISLICRAHQLAQDGFRWHFGQLLVTIWSAPNYCYRCGNKAAILRLNAAGDYD 290
            ....:.:|....|..|:||||.:.:||:.:...:.|||::||||||....|..|::.::......
Yeast   583 NKVAINKFLNKFGFDLVCRAHMVVEDGYEFFNDRSLVTVFSAPNYCGEFDNWGAVMSVSEGLLCS 647

  Fly   291 FKVFE-------AQALHSKPQPRKPKKRCRQFFQ 317
            |::.:       .|.:....|.||...:.:|..:
Yeast   648 FELLDPLDSAALKQVMKKGRQERKLANQQQQMME 681

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 111/282 (39%)
MPP_superfamily 12..296 CDD:301300 109/271 (40%)
PPZ1NP_013696.1 MPP_PP1_PPKL 362..653 CDD:277359 109/264 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.