DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and PPT1

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_011639.3 Gene:PPT1 / 853023 SGDID:S000003355 Length:513 Species:Saccharomyces cerevisiae


Alignment Length:289 Identity:110/289 - (38%)
Similarity:155/289 - (53%) Gaps:21/289 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LPRELEVRQLCRSLSDLLVGESNLLSLQ---SPQI---VCGDIHGQFEDLLHLLELGGSV-QEHR 84
            ||::. |..:......|...|.:::.|:   :|.:   ||||.||||.|:|:|....|.| .:|.
Yeast   209 LPKKY-VAAIISHADTLFRQEPSMVELENNSTPDVKISVCGDTHGQFYDVLNLFRKFGKVGPKHT 272

  Fly    85 YLFLGDLVDRGKNSVETFLLLAALKVRHPAQVSLLRGNHECRSATRSYGFYEECLSRYGSANVWR 149
            |||.||.||||..|.|..||...||:.||....|.|||||..:..:.|||.:||..:| |..::.
Yeast   273 YLFNGDFVDRGSWSCEVALLFYCLKILHPNNFFLNRGNHESDNMNKIYGFEDECKYKY-SQRIFN 336

  Fly   150 MCCRVFDLLPLAAIIDGNILCVHGGLSPD-MQRLDDLRSLDRCHEIPESGIIADLLWSDPQEAPG 213
            |..:.|:.||||.:|:.:.|.:||||..| ...|.|.:::||..:.|..|...:|||:|||||.|
Yeast   337 MFAQSFESLPLATLINNDYLVMHGGLPSDPSATLSDFKNIDRFAQPPRDGAFMELLWADPQEANG 401

  Fly   214 WAASPRGHGKLFGGDVVEEFTRANGISLICRAHQLAQDGFRWHFGQLLVTIWSAPNYCYRCGNKA 278
            ...|.||.|..||.|:.:.|.|.|.:..|.|:|:|...|.::.....|:|::||||||...||..
Yeast   402 MGPSQRGLGHAFGPDITDRFLRNNKLRKIFRSHELRMGGVQFEQKGKLMTVFSAPNYCDSQGNLG 466

  Fly   279 AILR-------LNAAGDYD----FKVFEA 296
            .::.       |.|..:.|    .:.|||
Yeast   467 GVIHVVPGHGILQAGRNDDQNLIIETFEA 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 110/289 (38%)
MPP_superfamily 12..296 CDD:301300 108/287 (38%)
PPT1NP_011639.3 PLN03088 10..>130 CDD:215568
TPR repeat 12..40 CDD:276809
TPR repeat 45..75 CDD:276809
TPR repeat 80..108 CDD:276809
MPP_PP5_C 165..508 CDD:277362 110/289 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.