DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and SIT4

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_010236.1 Gene:SIT4 / 851513 SGDID:S000002205 Length:311 Species:Saccharomyces cerevisiae


Alignment Length:291 Identity:153/291 - (52%)
Similarity:198/291 - (68%) Gaps:14/291 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EAMNDADRLVENLRHVPVRLPRELEVRQLCRSLSDLLVGESNLLSLQSPQIVCGDIHGQFEDLLH 72
            |.:.....|.||            |::|||..:.:||:.|||:..:|:|..|||||||||.|||.
Yeast    11 ETIKKCQALTEN------------EMKQLCEMVKELLMEESNIQPVQTPVTVCGDIHGQFHDLLE 63

  Fly    73 LLE-LGGSVQEHRYLFLGDLVDRGKNSVETFLLLAALKVRHPAQVSLLRGNHECRSATRSYGFYE 136
            |.. .||...:..|:||||.||||..|:|||.||..|||::||:::|:|||||.|..|:.|||||
Yeast    64 LFRTAGGFPDDINYIFLGDYVDRGYYSLETFTLLMCLKVKYPAKITLVRGNHESRQITQVYGFYE 128

  Fly   137 ECLSRYGSANVWRMCCRVFDLLPLAAIIDGNILCVHGGLSPDMQRLDDLRSLDRCHEIPESGIIA 201
            |||::|||..||:.||:|||.|.|||||||.||||||||||:::.||.:|.|.|..|:|..|..:
Yeast   129 ECLNKYGSTTVWKYCCQVFDFLTLAAIIDGKILCVHGGLSPEIRMLDQIRVLSRAQEVPHEGGFS 193

  Fly   202 DLLWSDPQEAPGWAASPRGHGKLFGGDVVEEFTRANGISLICRAHQLAQDGFRWHFGQL-LVTIW 265
            |||||||.....|..||||.|.|||..|..||...||::||.|||||..:||::||.:. :||:|
Yeast   194 DLLWSDPDNVEAWQVSPRGAGWLFGSKVAREFNHVNGLNLIARAHQLVMEGFKYHFPEKDVVTVW 258

  Fly   266 SAPNYCYRCGNKAAILRLNAAGDYDFKVFEA 296
            |||||||||||.|::::::...:..||:|.|
Yeast   259 SAPNYCYRCGNVASVMKVDEDLEPTFKIFSA 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 152/287 (53%)
MPP_superfamily 12..296 CDD:301300 151/285 (53%)
SIT4NP_010236.1 MPP_PP2A_PP4_PP6 7..291 CDD:277360 153/291 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.