DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and PPH21

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_010147.1 Gene:PPH21 / 851421 SGDID:S000002292 Length:369 Species:Saccharomyces cerevisiae


Alignment Length:295 Identity:140/295 - (47%)
Similarity:195/295 - (66%) Gaps:4/295 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MNDADRLVENL-RHVPVRLPRELEVRQLCRSLSDLLVGESNLLSLQSPQIVCGDIHGQFEDLLHL 73
            :|..|:.:|:| :..|:   .|.:|.:||:...|:|..|.|:..:..|..:|||:||||.|||.|
Yeast    67 INQLDQWIEHLSKCEPL---SEDDVARLCKMAVDVLQFEENVKPINVPVTICGDVHGQFHDLLEL 128

  Fly    74 LELGGSVQEHRYLFLGDLVDRGKNSVETFLLLAALKVRHPAQVSLLRGNHECRSATRSYGFYEEC 138
            .::||...:..|||:||.||||..||||...|.|:|||:|.::::||||||.|..|:.||||:||
Yeast   129 FKIGGPCPDTNYLFMGDYVDRGYYSVETVSYLVAMKVRYPHRITILRGNHESRQITQVYGFYDEC 193

  Fly   139 LSRYGSANVWRMCCRVFDLLPLAAIIDGNILCVHGGLSPDMQRLDDLRSLDRCHEIPESGIIADL 203
            |.:|||||||:|...:||..|:.|::|..|.|:||||||.::.:|.:|.|:|..|:|..|.:.||
Yeast   194 LRKYGSANVWKMFTDLFDYFPITALVDNKIFCLHGGLSPMIETIDQVRELNRIQEVPHEGPMCDL 258

  Fly   204 LWSDPQEAPGWAASPRGHGKLFGGDVVEEFTRANGISLICRAHQLAQDGFRWHFGQLLVTIWSAP 268
            |||||.:..||..||||.|..||.||.|:|...|.:|||.|||||..:|:.|...|.:|||:|||
Yeast   259 LWSDPDDRGGWGISPRGAGFTFGQDVSEQFNHTNDLSLIARAHQLVMEGYAWSHQQNVVTIFSAP 323

  Fly   269 NYCYRCGNKAAILRLNAAGDYDFKVFEAQALHSKP 303
            ||||||||:|||:.::...:..|..::......:|
Yeast   324 NYCYRCGNQAAIMEVDENHNRQFLQYDPSVRPGEP 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 139/293 (47%)
MPP_superfamily 12..296 CDD:301300 138/284 (49%)
PPH21NP_010147.1 MPP_PP2A_PP4_PP6 70..352 CDD:277360 138/284 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S48
OMA 1 1.010 - - QHG53795
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.730

Return to query results.
Submit another query.