DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and FYPP1

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_175454.1 Gene:FYPP1 / 841459 AraportID:AT1G50370 Length:303 Species:Arabidopsis thaliana


Alignment Length:300 Identity:151/300 - (50%)
Similarity:199/300 - (66%) Gaps:10/300 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DADRLVENLR---HVPVRLPRELEVRQLCRSLSDLLVGESNLLSLQSPQIVCGDIHGQFEDLLHL 73
            |.|:.:..::   |:     .|.|::.||..:.::|:.|||:..:.||..|||||||||.||:.|
plant     2 DLDQWISKVKDGQHL-----SEDELQLLCEYVKEILIEESNVQPVNSPVTVCGDIHGQFHDLMKL 61

  Fly    74 LELGGSVQEHRYLFLGDLVDRGKNSVETFLLLAALKVRHPAQVSLLRGNHECRSATRSYGFYEEC 138
            .:.||.|.|..|:|:||.||||.||:|.|.:|..||.||||.::|||||||.|..|:.||||:||
plant    62 FQTGGHVPETNYIFMGDFVDRGYNSLEVFTILLLLKARHPANITLLRGNHESRQLTQVYGFYDEC 126

  Fly   139 LSRYGSANVWRMCCRVFDLLPLAAIIDGNILCVHGGLSPDMQRLDDLRSLDRCHEIPESGIIADL 203
            ..:||:||.||.|..|||.|.|:|||||.:||||||||||::.:|.:|.::|..|||..|...||
plant   127 QRKYGNANAWRYCTDVFDYLTLSAIIDGTVLCVHGGLSPDVRTIDQIRLIERNCEIPHEGPFCDL 191

  Fly   204 LWSDPQEAPGWAASPRGHGKLFGGDVVEEFTRANGISLICRAHQLAQDGFRWHF-GQLLVTIWSA 267
            :||||::...||.||||.|.|||..|..||...|.:.|:||||||.|:|.::.| .:.|||:|||
plant   192 MWSDPEDIETWAVSPRGAGWLFGSRVTTEFNHINNLDLVCRAHQLVQEGLKYMFQDKGLVTVWSA 256

  Fly   268 PNYCYRCGNKAAILRLNAAGDYDFKVF-EAQALHSKPQPR 306
            |||||||||.|:||..|...:.:.|.| |.:..:....||
plant   257 PNYCYRCGNVASILSFNDNMEREVKFFTETEENNQMRGPR 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 150/299 (50%)
MPP_superfamily 12..296 CDD:301300 148/288 (51%)
FYPP1NP_175454.1 MPP_PP2A_PP4_PP6 2..285 CDD:277360 148/287 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D808922at2759
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.