DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and PP2A-2

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001322206.1 Gene:PP2A-2 / 837583 AraportID:AT1G10430 Length:306 Species:Arabidopsis thaliana


Alignment Length:297 Identity:148/297 - (49%)
Similarity:194/297 - (65%) Gaps:11/297 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DADRLVENLRHV-PVRLPRELEVRQLCRSLSDLLVGESNLLSLQSPQIVCGDIHGQFEDLLHLLE 75
            |.||.:|.|... |:   .|.:||.||.....:||.|.|:..::.|..|||||||||.||:.|..
plant     6 DLDRQIEQLMECKPL---SEADVRTLCDQARAILVEEYNVQPVKCPVTVCGDIHGQFYDLIELFR 67

  Fly    76 LGGSVQEHRYLFLGDLVDRGKNSVETFLLLAALKVRHPAQVSLLRGNHECRSATRSYGFYEECLS 140
            :||:..:..|||:||.||||..||||..||.|||||:..::::||||||.|..|:.||||:|||.
plant    68 IGGNAPDTNYLFMGDYVDRGYYSVETVSLLVALKVRYRDRLTILRGNHESRQITQVYGFYDECLR 132

  Fly   141 RYGSANVWRMCCRVFDLLPLAAIIDGNILCVHGGLSPDMQRLDDLRSLDRCHEIPESGIIADLLW 205
            :||:||||:....:||.|||.|:|:..:.|:||||||.:..||::|||||..|:|..|.:.||||
plant   133 KYGNANVWKYFTDLFDYLPLTALIESQVFCLHGGLSPSLDTLDNIRSLDRIQEVPHEGPMCDLLW 197

  Fly   206 SDPQEAPGWAASPRGHGKLFGGDVVEEFTRANGISLICRAHQLAQDGFRWHFGQLLVTIWSAPNY 270
            |||.:..||..||||.|..||.|:..:|...||:|||.|||||..:||.|...:.:||::|||||
plant   198 SDPDDRCGWGISPRGAGYTFGQDIAAQFNHNNGLSLISRAHQLVMEGFNWCQDKNVVTVFSAPNY 262

  Fly   271 CYRCGNKAAILRLNAAGDYDFKVFEAQALHSKPQPRK 307
            ||||||.||||.:....:.:|..|:       |.||:
plant   263 CYRCGNMAAILEIGENMEQNFLQFD-------PAPRQ 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 147/295 (50%)
MPP_superfamily 12..296 CDD:301300 145/284 (51%)
PP2A-2NP_001322206.1 MPP_PP2A_PP4_PP6 6..290 CDD:277360 146/293 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D808922at2759
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.790

Return to query results.
Submit another query.