DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and PPX2

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001330655.1 Gene:PPX2 / 835619 AraportID:AT5G55260 Length:346 Species:Arabidopsis thaliana


Alignment Length:344 Identity:158/344 - (45%)
Similarity:206/344 - (59%) Gaps:50/344 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MNDADRLVENLRHVPVRLPRELEVRQLCRSLSDLLVGESNLLSLQSPQIVCGDIHGQFEDLLHLL 74
            |:|.|:.:|.|:.....  :|.||:.||....::||.|||:..:.:|..:||||||||.|:..|.
plant     1 MSDLDKQIEQLKRCEAL--KESEVKALCLKAMEILVEESNVQRVDAPVTICGDIHGQFYDMKELF 63

  Fly    75 ELGGSVQEHRYLFLGDLVDRGKNSVETFLLLAALK------------------------------ 109
            ::||...:..||||||.||||..||||||||.|||                              
plant    64 KVGGDCPKTNYLFLGDFVDRGFYSVETFLLLLALKVIINSPTVVYFGLCKEMNELDGLLCKWVLG 128

  Fly   110 -----------VRHPAQVSLLRGNHECRSATRSYGFYEECLSRYGSANVWRMCCRVFDLLPLAAI 163
                       ||:|.:::|:|||||.|..|:.||||:|||.:|||.||||.|..:||.|.|:|:
plant   129 SLNFGYFLHSQVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSVNVWRYCTDIFDYLSLSAL 193

  Fly   164 IDGNILCVHGGLSPDMQRLDDLRSLDRCHEIPESGIIADLLWSDPQE-APGWAASPRGHGKLFGG 227
            ::..|.||||||||.:..||.:|::||..|:|..|.:.|||||||:: ..||..||||.|.||||
plant   194 VENKIFCVHGGLSPAIMTLDQIRAIDRKQEVPHDGAMCDLLWSDPEDIVDGWGLSPRGAGFLFGG 258

  Fly   228 DVVEEFTRANGISLICRAHQLAQDGFRWHFGQLLVTIWSAPNYCYRCGNKAAILRLNAAGDYDFK 292
            .||..|..:|.|..|||||||..:|::|.|...:||:||||||||||||.||||.|:...:.:|:
plant   259 SVVTSFNHSNNIDYICRAHQLVMEGYKWMFNSQIVTVWSAPNYCYRCGNVAAILELDENLNKEFR 323

  Fly   293 VFEAQ------ALHSKPQP 305
            ||:|.      ||..||.|
plant   324 VFDAAPQESRGALAKKPAP 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 157/342 (46%)
MPP_superfamily 12..296 CDD:301300 151/325 (46%)
PPX2NP_001330655.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D808922at2759
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45619
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.890

Return to query results.
Submit another query.