DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and PPX1

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_194402.1 Gene:PPX1 / 828779 AraportID:AT4G26720 Length:305 Species:Arabidopsis thaliana


Alignment Length:302 Identity:154/302 - (50%)
Similarity:208/302 - (68%) Gaps:6/302 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MNDADRLVENLRHV-PVRLPRELEVRQLCRSLSDLLVGESNLLSLQSPQIVCGDIHGQFEDLLHL 73
            |:|.||.:..|:.. |:   .|.||:.||....::||.|||:..:.:|..:||||||||.|::.|
plant     1 MSDLDRQIGQLKRCEPL---SESEVKALCLKAMEILVEESNVQRVDAPVTLCGDIHGQFYDMMEL 62

  Fly    74 LELGGSVQEHRYLFLGDLVDRGKNSVETFLLLAALKVRHPAQVSLLRGNHECRSATRSYGFYEEC 138
            .::||...:..|||:||.||||..||||||||.|||||:|.:::|:|||||.|..|:.||||:||
plant    63 FKVGGDCPKTNYLFMGDFVDRGYYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDEC 127

  Fly   139 LSRYGSANVWRMCCRVFDLLPLAAIIDGNILCVHGGLSPDMQRLDDLRSLDRCHEIPESGIIADL 203
            |.:|||:||||.|..:||.:.|:|:::..|.||||||||.:..||.:|::||..|:|..|.:.||
plant   128 LRKYGSSNVWRYCTDIFDYMSLSAVVENKIFCVHGGLSPAIMTLDQIRTIDRKQEVPHDGAMCDL 192

  Fly   204 LWSDPQE-APGWAASPRGHGKLFGGDVVEEFTRANGISLICRAHQLAQDGFRWHFGQLLVTIWSA 267
            |||||:: ..||..||||.|.||||.||..|..:|.|..|.|||||..:|::|.|...:||:|||
plant   193 LWSDPEDIVDGWGLSPRGAGFLFGGSVVTSFNHSNNIDYIARAHQLVMEGYKWMFDSQIVTVWSA 257

  Fly   268 PNYCYRCGNKAAILRLNAAGDYDFKVFEAQALHSK-PQPRKP 308
            |||||||||.|:||.|:...:.:|:||:|....|: |..:||
plant   258 PNYCYRCGNVASILELDENLNKEFRVFDAAQQDSRGPPAKKP 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 151/297 (51%)
MPP_superfamily 12..296 CDD:301300 148/285 (52%)
PPX1NP_194402.1 MPP_PP2A_PP4_PP6 3..287 CDD:277360 148/286 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D808922at2759
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45619
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.890

Return to query results.
Submit another query.