DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and Ppp6c

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_077171.1 Gene:Ppp6c / 67857 MGIID:1915107 Length:305 Species:Mus musculus


Alignment Length:285 Identity:148/285 - (51%)
Similarity:195/285 - (68%) Gaps:2/285 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DADRLVENLRHVPVRLPRELEVRQLCRSLSDLLVGESNLLSLQSPQIVCGDIHGQFEDLLHLLEL 76
            |.|:.||..|.... || |.::::||..:.|||:.|||:..:.:|..|||||||||.||..|...
Mouse     5 DLDKYVEIARQCKY-LP-ENDLKRLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFYDLCELFRT 67

  Fly    77 GGSVQEHRYLFLGDLVDRGKNSVETFLLLAALKVRHPAQVSLLRGNHECRSATRSYGFYEECLSR 141
            ||.|.:..|:|:||.||||..|:|||..|.|||.:.|.:::|||||||.|..|:.||||:||.::
Mouse    68 GGQVPDTNYIFMGDFVDRGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTK 132

  Fly   142 YGSANVWRMCCRVFDLLPLAAIIDGNILCVHGGLSPDMQRLDDLRSLDRCHEIPESGIIADLLWS 206
            ||:||.||.|.:|||:|.:||:||..|||||||||||::.||.:|:::|..|||..|...||:||
Mouse   133 YGNANAWRYCTKVFDMLTVAALIDEQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWS 197

  Fly   207 DPQEAPGWAASPRGHGKLFGGDVVEEFTRANGISLICRAHQLAQDGFRWHFGQLLVTIWSAPNYC 271
            ||::...||.||||.|.|||..|..||...|.:.||||||||..:|:::.|.:.|||:|||||||
Mouse   198 DPEDVDTWAISPRGAGWLFGAKVTNEFVHINNLKLICRAHQLVHEGYKFMFDEKLVTVWSAPNYC 262

  Fly   272 YRCGNKAAILRLNAAGDYDFKVFEA 296
            |||||.|:|:........:.|:|.|
Mouse   263 YRCGNIASIMVFKDVNTREPKLFRA 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 148/285 (52%)
MPP_superfamily 12..296 CDD:301300 147/283 (52%)
Ppp6cNP_077171.1 MPP_PP2A_PP4_PP6 5..289 CDD:277360 148/285 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.