DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and Ppp5c

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_006228527.2 Gene:Ppp5c / 65179 RGDID:68415 Length:594 Species:Rattus norvegicus


Alignment Length:266 Identity:110/266 - (41%)
Similarity:151/266 - (56%) Gaps:16/266 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LCRSLSDLL------VGESNLLSLQSPQI-------VCGDIHGQFEDLLHLLELGGSVQE-HRYL 86
            :|..||.|:      ...|..|.|:.|..       ||||.||||.|||::.||.|...| :.|:
  Rat   298 VCCDLSPLIPLCPLPTSLSGPLPLRWPLFFQTEKITVCGDTHGQFYDLLNIFELNGLPSETNPYI 362

  Fly    87 FLGDLVDRGKNSVETFLLLAALKVRHPAQVSLLRGNHECRSATRSYGFYEECLSRYGSANVWRMC 151
            |.||.||||..|||..|.|...|:.:|....|||||||..:..:.|||..|..::| :|.::.:.
  Rat   363 FNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKY-TAQMYELF 426

  Fly   152 CRVFDLLPLAAIIDGNILCVHGGL-SPDMQRLDDLRSLDRCHEIPESGIIADLLWSDPQEAPGWA 215
            ..||:.||||..|:|.:|.:|||| |.|...|||:|.::|..:.|:||.:.||||||||...|.:
  Rat   427 SEVFEWLPLAQCINGKVLIMHGGLFSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRS 491

  Fly   216 ASPRGHGKLFGGDVVEEFTRANGISLICRAHQLAQDGFRWHFGQLLVTIWSAPNYCYRCGNKAAI 280
            .|.||....||.||.:.|...|.:..|.|:|::..:|:....|...||::||||||.:.||||:.
  Rat   492 VSKRGVSCQFGPDVTKAFLEENQLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASY 556

  Fly   281 LRLNAA 286
            :.|..:
  Rat   557 IHLQGS 562

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 110/266 (41%)
MPP_superfamily 12..296 CDD:301300 110/266 (41%)
Ppp5cXP_006228527.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.