DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and Pp1-Y1

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001104152.3 Gene:Pp1-Y1 / 5740113 FlyBaseID:FBgn0261399 Length:317 Species:Drosophila melanogaster


Alignment Length:283 Identity:123/283 - (43%)
Similarity:168/283 - (59%) Gaps:14/283 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ELEVRQLCRSLSDLLVGESNLLSLQSPQIVCGDIHGQFEDLLHLLELGGSVQEHRYLFLGDLVDR 94
            |.::.:|.:....:|:.|..||::::|..|.||||||:.|||...|..|...:.|||.|||.|||
  Fly    37 ESDIIKLLKQARQVLMSEPMLLTVEAPVNVLGDIHGQYNDLLRYFETSGHPPKKRYLMLGDYVDR 101

  Fly    95 GKNSVETFLLLAALKVRHPAQVSLLRGNHECRSATRSYGFYEECLSRYGSANVWRMCCRVFDLLP 159
            ||.||||..||.|.|||:|..:.|||||||..:..|.||||:||..|: :..:|||....:|.||
  Fly   102 GKYSVETLTLLLAYKVRYPTSIHLLRGNHESAAINRYYGFYDECKRRF-TIRLWRMFVDCYDCLP 165

  Fly   160 LAAIIDGNILCVHGGLSPDMQRLDDLRSLDRCHEIPESGIIADLLWSDPQ-EAPGWAASPRGHGK 223
            :||||:..|.|.||||||.:..|:|::.|.|..|:..:|::.|||||||. .|.||..:.||...
  Fly   166 VAAIINSKIFCCHGGLSPSLHNLNDIQHLQRPAEVDRNGLLCDLLWSDPDPTAIGWEKNSRGVSF 230

  Fly   224 LFGGDVVEEFTRANGISLICRAHQLAQDGFRWHFGQLLVTIWSAPNYCYRCGNKAAILRLNAAGD 288
            .||.|:||.|.......|||||||:.:||:.:...:.|:|::||.|||....|..|::.::|..:
  Fly   231 TFGVDIVETFLSRFSFDLICRAHQVVEDGYEFFAKRQLITVFSAVNYCGEFDNAGAMMCVDAELN 295

  Fly   289 YDFKVFEAQALHSKPQPRKPKKR 311
            ....|.            |||||
  Fly   296 ITLVVM------------KPKKR 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 118/277 (43%)
MPP_superfamily 12..296 CDD:301300 118/266 (44%)
Pp1-Y1NP_001104152.3 MPP_superfamily 17..303 CDD:301300 118/278 (42%)
PP2Ac 36..305 CDD:197547 120/280 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438776
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.