DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and ppp3cca

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_005171933.1 Gene:ppp3cca / 557926 ZFINID:ZDB-GENE-030829-36 Length:508 Species:Danio rerio


Alignment Length:342 Identity:126/342 - (36%)
Similarity:175/342 - (51%) Gaps:55/342 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EAMNDADRLVENLRHVPVRLPRELEVRQL--------------------------CRSLSD---L 43
            |.::..:|:::.   ||:...:.|.::.|                          .|.::|   :
Zfish     8 EKLSTTERIIKT---VPLPPHQRLTIKDLYVDGKPNTELLKNHLIKEGRVEEDAALRIINDGANI 69

  Fly    44 LVGESNLLSLQSPQIVCGDIHGQFEDLLHLLELGGSVQEHRYLFLGDLVDRGKNSVETFLLLAAL 108
            |..|..:|.:::|..||||:||||.||:.|.|:|||....|||||||.||||..|:|..|.|..|
Zfish    70 LRQEKCMLEVEAPITVCGDVHGQFFDLMKLFEVGGSPDNTRYLFLGDYVDRGYFSIECVLFLWTL 134

  Fly   109 KVRHPAQVSLLRGNHECRSATRSYGFYEECLSRYGSANVWRMCCRVFDLLPLAAIIDGNILCVHG 173
            |:.||..:.|||||||||..|..:.|.:||..:| |..|:..|...||.|||||:::...|||||
Zfish   135 KINHPNTLFLLRGNHECRHLTEYFTFKQECKIKY-SERVYDACMEAFDCLPLAALLNQQFLCVHG 198

  Fly   174 GLSPDMQRLDDLRSLDRCHEIPESGIIADLLWSDPQEAPGWAA--------SPRGHGKLFGGDVV 230
            ||||::..|||:|.|||..|.|..|.:.||:|:||.|..|...        |.||....|....|
Zfish   199 GLSPEINCLDDIRKLDRFKEPPAFGPMCDLIWADPGEDYGSEKTAEHFNHNSVRGCSYFFSYAAV 263

  Fly   231 EEFTRANGISLICRAHQLAQDGFRWH-------FGQLLVTIWSAPNYCYRCGNKAAILRLNAAGD 288
            .:|...|.:..:.|||:....|:|.:       |.. |:||:|||||.....||||:|:      
Zfish   264 CDFLTNNNLLSVIRAHEAQDAGYRMYRKSQTTGFPS-LITIFSAPNYLDVYNNKAAVLK------ 321

  Fly   289 YDFKVFEAQALHSKPQP 305
            |:..|...:..:..|.|
Zfish   322 YENNVMNIRQFNCSPHP 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 125/338 (37%)
MPP_superfamily 12..296 CDD:301300 123/327 (38%)
ppp3ccaXP_005171933.1 MPP_PP2B 39..343 CDD:277361 120/308 (39%)
PP2Ac 59..327 CDD:197547 117/275 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.