DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and PPP6C

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001116827.1 Gene:PPP6C / 5537 HGNCID:9323 Length:342 Species:Homo sapiens


Alignment Length:262 Identity:140/262 - (53%)
Similarity:183/262 - (69%) Gaps:0/262 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 QLCRSLSDLLVGESNLLSLQSPQIVCGDIHGQFEDLLHLLELGGSVQEHRYLFLGDLVDRGKNSV 99
            :||..:.|||:.|||:..:.:|..|||||||||.||..|...||.|.:..|:|:||.||||..|:
Human    63 RLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFYDLCELFRTGGQVPDTNYIFMGDFVDRGYYSL 127

  Fly   100 ETFLLLAALKVRHPAQVSLLRGNHECRSATRSYGFYEECLSRYGSANVWRMCCRVFDLLPLAAII 164
            |||..|.|||.:.|.:::|||||||.|..|:.||||:||.::||:||.||.|.:|||:|.:||:|
Human   128 ETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANAWRYCTKVFDMLTVAALI 192

  Fly   165 DGNILCVHGGLSPDMQRLDDLRSLDRCHEIPESGIIADLLWSDPQEAPGWAASPRGHGKLFGGDV 229
            |..|||||||||||::.||.:|:::|..|||..|...||:||||::...||.||||.|.|||..|
Human   193 DEQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDPEDVDTWAISPRGAGWLFGAKV 257

  Fly   230 VEEFTRANGISLICRAHQLAQDGFRWHFGQLLVTIWSAPNYCYRCGNKAAILRLNAAGDYDFKVF 294
            ..||...|.:.||||||||..:|:::.|.:.|||:||||||||||||.|:|:........:.|:|
Human   258 TNEFVHINNLKLICRAHQLVHEGYKFMFDEKLVTVWSAPNYCYRCGNIASIMVFKDVNTREPKLF 322

  Fly   295 EA 296
            .|
Human   323 RA 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 140/262 (53%)
MPP_superfamily 12..296 CDD:301300 139/260 (53%)
PPP6CNP_001116827.1 MPP_PP2A_PP4_PP6 5..326 CDD:277360 140/262 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D349967at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.