DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and PPP1CA

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001008709.1 Gene:PPP1CA / 5499 HGNCID:9281 Length:341 Species:Homo sapiens


Alignment Length:329 Identity:136/329 - (41%)
Similarity:192/329 - (58%) Gaps:32/329 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MNDAD---------RLVENLR----H-VPVRLPR--------ELEVRQLCRSLSDLLVGESNLLS 52
            |:|::         ||:|..|    | .||:..|        |.|:|.||....::.:.:..||.
Human     1 MSDSEKLNLDSIIGRLLEGSRVLTPHCAPVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLE 65

  Fly    53 LQSPQIVCGDIHGQFEDLLHLLELGGSVQEHRYLFLGDLVDRGKNSVETFLLLAALKVRHPAQVS 117
            |::|..:|||||||:.|||.|.|.||...|..||||||.|||||.|:||..||.|.|:::|....
Human    66 LEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFF 130

  Fly   118 LLRGNHECRSATRSYGFYEECLSRYGSANVWRMCCRVFDLLPLAAIIDGNILCVHGGLSPDMQRL 182
            ||||||||.|..|.||||:||..|| :..:|:.....|:.||:|||:|..|.|.|||||||:|.:
Human   131 LLRGNHECASINRIYGFYDECKRRY-NIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSM 194

  Fly   183 DDLRSLDRCHEIPESGIIADLLWSDP-QEAPGWAASPRGHGKLFGGDVVEEFTRANGISLICRAH 246
            :.:|.:.|..::|:.|::.||||||| ::..||..:.||....||.:||.:|...:.:.||||||
Human   195 EQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAH 259

  Fly   247 QLAQDGFRWHFGQLLVTIWSAPNYCYRCGNKAAILRLNAAGDYDFKVFEAQALHSKPQPRKPKKR 311
            |:.:||:.:...:.|||::||||||....|..|::.::......|::.       ||.. |.|.:
Human   260 QVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQIL-------KPAD-KNKGK 316

  Fly   312 CRQF 315
            ..||
Human   317 YGQF 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 131/317 (41%)
MPP_superfamily 12..296 CDD:301300 129/306 (42%)
PPP1CANP_001008709.1 PTZ00480 6..319 CDD:185658 132/321 (41%)
MPP_PP1_PPKL 8..309 CDD:277359 128/308 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.