DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and PPEF1

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001364915.1 Gene:PPEF1 / 5475 HGNCID:9243 Length:653 Species:Homo sapiens


Alignment Length:335 Identity:91/335 - (27%)
Similarity:147/335 - (43%) Gaps:67/335 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PEAMNDADRLVE-----NLRHVPVRLPRELEVRQLCRSLSDLLVGESNLLSLQSPQI-VCGDIHG 65
            |....|.|.|:|     .:.|....|....|.:::.:.:.:.    :::.:..|.:: :|||:||
Human   115 PLTCTDIDLLLEAFKEQQILHAHYVLEVLFETKKVLKQMPNF----THIQTSPSKEVTICGDLHG 175

  Fly    66 QFEDLLHLLELGGSVQEHR-YLFLGDLVDRGKNSVETFLLLAALKVRHPAQVSLLRGNHECRSAT 129
            :.:||..:....|...|.. |:|.||.|||||||:|..::|....:.:|..:.|.|||||.....
Human   176 KLDDLFLIFYKNGLPSERNPYVFNGDFVDRGKNSIEILMILCVSFLVYPNDLHLNRGNHEDFMMN 240

  Fly   130 RSYGFYEECLSRY--GSANVWRMCCRVFDLLPLAAIIDGNILCVHGGLSPDMQRLDDLRSLDRCH 192
            ..|||.:|.|.:|  ....:.::....:..||:..|:|..||.:|||:|    ...||..|.|..
Human   241 LRYGFTKEILHKYKLHGKRILQILEEFYAWLPIGTIVDNEILVIHGGIS----ETTDLNLLHRVE 301

  Fly   193 E-------IPES---------------GI-------------------------IADLLWSDPQE 210
            .       ||.:               |:                         |.|:|||||:.
Human   302 RNKMKSVLIPPTETNRDHDTDSKHNKVGVTFNAHGRIKTNGSPTEHLTEHEWEQIIDILWSDPRG 366

  Fly   211 APG-WAASPRGHGKLFGGDVVEEFTRANGISLICRAHQLAQDGFR-WHFGQLLVTIWSAPNYCYR 273
            ..| :..:.||.|..||.||..:......:.::.|:|:...:|:. .|.|: :|||:||.||...
Human   367 KNGCFPNTCRGGGCYFGPDVTSKILNKYQLKMLIRSHECKPEGYEICHDGK-VVTIFSASNYYEE 430

  Fly   274 CGNKAAILRL 283
            ..|:.|.::|
Human   431 GSNRGAYIKL 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 90/330 (27%)
MPP_superfamily 12..296 CDD:301300 90/330 (27%)
PPEF1NP_001364915.1 IQ 18..37 CDD:197470
MPP_RdgC 115..452 CDD:277364 91/335 (27%)
Catalytic 121..455 89/329 (27%)
EF-hand_7 568..636 CDD:404394
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.