DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and PpD3

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001262433.1 Gene:PpD3 / 49779 FlyBaseID:FBgn0005777 Length:520 Species:Drosophila melanogaster


Alignment Length:280 Identity:107/280 - (38%)
Similarity:155/280 - (55%) Gaps:13/280 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RLPRELEVRQLCRSLSDLLVGESNLLSLQSPQ----IVCGDIHGQFEDLLHLLELGGSVQE-HRY 85
            ||.|:...:.|| .:...:..:.:|:.:..|.    .:||||||||.||:::.|:.|...| :.|
  Fly   225 RLHRKFAYKILC-EIDTYMRAQPSLVDITVPDEEKFTICGDIHGQFYDLMNIFEINGLPSEKNPY 288

  Fly    86 LFLGDLVDRGKNSVETFLLLAALKVRHPAQVSLLRGNHECRSATRSYGFYEECLSRYGSANVWRM 150
            ||.||.||||..|||....|...|:.:|....|.|||||..:..:.|||..|..::|.|| :..:
  Fly   289 LFNGDFVDRGSFSVECIFTLFGFKLLYPNHFFLARGNHESINMNQMYGFTGEVTAKYTSA-MADI 352

  Fly   151 CCRVFDLLPLAAIIDGNILCVHGGL-SPDMQRLDDLRSLDRCHEIPESGIIADLLWSDPQEAPGW 214
            ..:||:.|||...|:..||.:|||| |.:...||.:|.::|..:.||.|::.:|||||||:..|.
  Fly   353 FTQVFNWLPLCHCINQKILVMHGGLFSTEDVTLDHIRRIERNCQPPEEGLMCELLWSDPQQWMGL 417

  Fly   215 AASPRGHGKLFGGDVVEEFTRANGISLICRAHQLAQDGFRWHFGQLLVTIWSAPNYCYRCGNKAA 279
            ..|.||.|..||.||.|:|.:.|.:..|.|:|::...|:........:|::||||||...||..|
  Fly   418 GQSKRGVGIQFGPDVTEKFCKDNNLDYIIRSHEVKDMGYEVAHNGKCITVFSAPNYCDTMGNMGA 482

  Fly   280 ILRL---NAAGDYDFKVFEA 296
            .:.:   |...:|  |.|||
  Fly   483 FITITGNNLKPNY--KSFEA 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 107/280 (38%)
MPP_superfamily 12..296 CDD:301300 105/278 (38%)
PpD3NP_001262433.1 TPR_11 49..114 CDD:290150
TPR_1 49..81 CDD:278916
TPR repeat 49..77 CDD:276809
TPR repeat 82..112 CDD:276809
MPP_PP5_C 198..513 CDD:277362 107/280 (38%)
PP2Ac 226..502 CDD:197547 106/279 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438822
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.