DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and Pp1-87B

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_524937.1 Gene:Pp1-87B / 49260 FlyBaseID:FBgn0004103 Length:302 Species:Drosophila melanogaster


Alignment Length:309 Identity:128/309 - (41%)
Similarity:183/309 - (59%) Gaps:16/309 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EAMNDADRLVENLRHVPVRLP------RELEVRQLCRSLSDLLVGESNLLSLQSPQIVCGDIHGQ 66
            :.|| .|.::..|..|....|      .|.|:|.||....::.:.:..||.|::|..:|||||||
  Fly     3 DVMN-IDSIISRLLEVRGARPGKNVQLSEGEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQ 66

  Fly    67 FEDLLHLLELGGSVQEHRYLFLGDLVDRGKNSVETFLLLAALKVRHPAQVSLLRGNHECRSATRS 131
            :.|||.|.|.||...|..||||||.|||||.|:||..||.|.|:::.....||||||||.|..|.
  Fly    67 YYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRI 131

  Fly   132 YGFYEECLSRYGSANVWRMCCRVFDLLPLAAIIDGNILCVHGGLSPDMQRLDDLRSLDRCHEIPE 196
            ||||:||..|| |..:|:.....|:.||:|||:|..|.|.|||||||:..::.:|.:.|..::|:
  Fly   132 YGFYDECKRRY-SIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPD 195

  Fly   197 SGIIADLLWSDP-QEAPGWAASPRGHGKLFGGDVVEEFTRANGISLICRAHQLAQDGFRWHFGQL 260
            .|::.||||||| ::..||..:.||....||.:||.:|.:.:...|||||||:.:||:.:...::
  Fly   196 QGLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVAKFLQKHEFDLICRAHQVVEDGYEFFAKRM 260

  Fly   261 LVTIWSAPNYCYRCGNKAAILRLNAAGDYDFKVFEAQALHSKPQPRKPK 309
            |||::||||||....|..|::.::......|::.       ||..::.|
  Fly   261 LVTLFSAPNYCGEFDNAGAMMSVDDTLMCSFQIL-------KPADKRKK 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 125/301 (42%)
MPP_superfamily 12..296 CDD:301300 123/290 (42%)
Pp1-87BNP_524937.1 MPP_PP1_PPKL 6..296 CDD:277359 124/298 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438831
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.