DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and PpY-55A

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001286554.1 Gene:PpY-55A / 48532 FlyBaseID:FBgn0003140 Length:314 Species:Drosophila melanogaster


Alignment Length:259 Identity:104/259 - (40%)
Similarity:154/259 - (59%) Gaps:3/259 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LPRELEVRQLCRSLSDLLVGESNLLSLQSPQIVCGDIHGQFEDLLHLLELGGSVQEHRYLFLGDL 91
            |..|| :.:|.:...:::..:..||.||:|..:||||||||.|||.:.:..|...:..||||||.
  Fly    26 LKEEL-IERLIQQTREVIKWQPMLLELQAPVNICGDIHGQFTDLLRIFKACGFPPKANYLFLGDY 89

  Fly    92 VDRGKNSVETFLLLAALKVRHPAQVSLLRGNHECRSATRSYGFYEECLSRYGSANVWRMCCRVFD 156
            |||||.|:||..||.|.||::|....|||||||..|..:.||||:| :.|..:..:|......|:
  Fly    90 VDRGKQSLETICLLFAYKVKYPLNFFLLRGNHESASINKIYGFYDE-IKRRHTVRLWHSFTDCFN 153

  Fly   157 LLPLAAIIDGNILCVHGGLSPDMQRLDDLRSLDRCHEIPESGIIADLLWSD-PQEAPGWAASPRG 220
            .||:||::...|.|.||||||.::.|..:..:.|..:||:.||:.||||:| .....||..:.||
  Fly   154 WLPVAALVGERIFCCHGGLSPSLRNLQQINHIQRPTDIPDEGIMCDLLWADLNHTTKGWGHNDRG 218

  Fly   221 HGKLFGGDVVEEFTRANGISLICRAHQLAQDGFRWHFGQLLVTIWSAPNYCYRCGNKAAILRLN 284
            ....|...:|.:|.:|..:.|:.|||::.:||:.:...:.|||::||||||....|...::.::
  Fly   219 VSFTFDKVIVRDFLKAFDLQLMVRAHEVVEDGYEFFANRQLVTVFSAPNYCGMMNNAGGVMSVS 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 104/259 (40%)
MPP_superfamily 12..296 CDD:301300 104/259 (40%)
PpY-55ANP_001286554.1 PTZ00480 8..310 CDD:185658 104/259 (40%)
MPP_PP1_PPKL 8..294 CDD:277359 104/259 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438835
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.