DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and ppp2cb

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001005443.1 Gene:ppp2cb / 448031 XenbaseID:XB-GENE-957248 Length:309 Species:Xenopus tropicalis


Alignment Length:313 Identity:150/313 - (47%)
Similarity:200/313 - (63%) Gaps:23/313 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EAMNDADRLVENLRHVPVRLPRELEVRQLCRSLSDLLVGESNLLSLQSPQIVCGDIHGQFEDLLH 72
            |.:||..:|            .|.:||.||....::|..|||:..::.|..||||:||||.||:.
 Frog    15 EQLNDCKQL------------NESQVRTLCEKAKEILTKESNVQDVRCPVTVCGDVHGQFHDLME 67

  Fly    73 LLELGGSVQEHRYLFLGDLVDRGKNSVETFLLLAALKVRHPAQVSLLRGNHECRSATRSYGFYEE 137
            |..:||...:..|||:||.||||..||||..||.|||||:|.::::||||||.|..|:.||||:|
 Frog    68 LFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHESRQITQVYGFYDE 132

  Fly   138 CLSRYGSANVWRMCCRVFDLLPLAAIIDGNILCVHGGLSPDMQRLDDLRSLDRCHEIPESGIIAD 202
            ||.:||:||||:....:||.|||.|::||.|.|:||||||.:..||.:|:|||..|:|..|.:.|
 Frog   133 CLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCD 197

  Fly   203 LLWSDPQEAPGWAASPRGHGKLFGGDVVEEFTRANGISLICRAHQLAQDGFRWHFGQLLVTIWSA 267
            ||||||.:..||..||||.|..||.|:.|.|..|||::|:.|||||..:|:.|...:.:|||:||
 Frog   198 LLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSA 262

  Fly   268 PNYCYRCGNKAAILRLNAAGDYDFKVFEAQALHSKPQPRKPK----KRCRQFF 316
            |||||||||:|||:.|:....|.|..|:       |.||:.:    :|...:|
 Frog   263 PNYCYRCGNQAAIMELDDTLKYSFLQFD-------PAPRRGEPHVTRRTPDYF 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 145/294 (49%)
MPP_superfamily 12..296 CDD:301300 143/283 (51%)
ppp2cbNP_001005443.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 146/296 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D349967at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.