DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and flw

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_727418.1 Gene:flw / 44289 FlyBaseID:FBgn0000711 Length:461 Species:Drosophila melanogaster


Alignment Length:281 Identity:127/281 - (45%)
Similarity:175/281 - (62%) Gaps:9/281 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ELEVRQLCRSLSDLLVGESNLLSLQSPQIVCGDIHGQFEDLLHLLELGGSVQEHRYLFLGDLVDR 94
            |.|||.||....::.:.:..||.|::|.|:|||||||:.|||.|.|.||......||||||.|||
  Fly   162 EAEVRGLCLKSREIFLQQPILLELEAPLIICGDIHGQYTDLLRLFEYGGFPPAANYLFLGDYVDR 226

  Fly    95 GKNSVETFLLLAALKVRHPAQVSLLRGNHECRSATRSYGFYEECLSRYGSANVWRMCCRVFDLLP 159
            ||.|:||..||.|.|:::|....||||||||.|..|.||||:||..|| :..:|:.....|:.||
  Fly   227 GKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRY-NVKLWKTFTDCFNCLP 290

  Fly   160 LAAIIDGNILCVHGGLSPDMQRLDDLRSLDRCHEIPESGIIADLLWSDP-QEAPGWAASPRGHGK 223
            :|||||..|.|.|||||||:|.::.:|.|.|..::|::|::.||||||| ::..||..:.||...
  Fly   291 VAAIIDEKIFCCHGGLSPDLQGMEQIRRLMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSF 355

  Fly   224 LFGGDVVEEFTRANGISLICRAHQLAQDGFRWHFGQLLVTIWSAPNYCYRCGNKAAILRLNAAGD 288
            .||.|||.:|...:.:.|||||||:.:||:.:...:.|||::||||||....|...::.::....
  Fly   356 TFGVDVVSKFLNRHELDLICRAHQVVEDGYEFFARRQLVTLFSAPNYCGEFDNAGGMMTVDDTLM 420

  Fly   289 YDFKVFEAQALHSKPQPRKPK 309
            ..|::.       ||..:|.|
  Fly   421 CSFQIL-------KPSEKKAK 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 125/277 (45%)
MPP_superfamily 12..296 CDD:301300 123/266 (46%)
flwNP_727418.1 MPP_PP1_PPKL 149..428 CDD:277359 123/273 (45%)
PP2Ac 160..430 CDD:197547 125/275 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438862
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.