DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and PpD5

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_524707.1 Gene:PpD5 / 44148 FlyBaseID:FBgn0005778 Length:346 Species:Drosophila melanogaster


Alignment Length:282 Identity:123/282 - (43%)
Similarity:172/282 - (60%) Gaps:7/282 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MNDADRLVENLRHVPVRLPR-----ELEVRQLCRSLSDLLVGESNLLSLQSPQIVCGDIHGQFED 69
            |:..|.::..|:.:.|...|     |..:..:|::..:|.:.:..||.|.:|..:|||:||||:|
  Fly    22 MSQLDVIIGQLKTMAVGNRRAGNLSEATITYICQASRELFLSQPMLLELSAPVKICGDLHGQFKD 86

  Fly    70 LLHLLELGGSVQEHRYLFLGDLVDRGKNSVETFLLLAALKVRHPAQVSLLRGNHECRSATRSYGF 134
            ||.:.:..|......||||||.||||..|:||..||...|:|:|....|||||||.....|.|||
  Fly    87 LLRIFQQCGVPPLSNYLFLGDYVDRGHCSIETLSLLLTYKLRYPETFFLLRGNHESADLNRVYGF 151

  Fly   135 YEECLSRYGSANVWRMCCRVFDLLPLAAIIDGNILCVHGGLSPDMQRLDDLRSLDRCHEIPESGI 199
            ::||..|| |..:||.....:|.:|:||||...|.|||||||||:..|||:|.|:|..::|..|:
  Fly   152 FDECKRRY-SIKLWRSFVDCYDCMPVAAIIADRIFCVHGGLSPDLNNLDDIRRLNRPTDVPSDGL 215

  Fly   200 IADLLWSDPQEAPG-WAASPRGHGKLFGGDVVEEFTRANGISLICRAHQLAQDGFRWHFGQLLVT 263
            :.|||||||.|..| ||::.||....||.::||.|...:..:||.||||:.:||:.:...:.|||
  Fly   216 LCDLLWSDPDETTGTWASNDRGVSFTFGANIVEGFLMQHKFNLIVRAHQVVEDGYEFFADRQLVT 280

  Fly   264 IWSAPNYCYRCGNKAAILRLNA 285
            |:||||||....|..|:|.::|
  Fly   281 IFSAPNYCDIFDNCGAVLVVDA 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 122/280 (44%)
MPP_superfamily 12..296 CDD:301300 122/280 (44%)
PpD5NP_524707.1 PTZ00480 19..339 CDD:185658 123/282 (44%)
MPP_superfamily 25..313 CDD:301300 122/279 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438774
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.