DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and ppp1caa

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_999976.1 Gene:ppp1caa / 407980 ZFINID:ZDB-GENE-040516-3 Length:331 Species:Danio rerio


Alignment Length:308 Identity:129/308 - (41%)
Similarity:185/308 - (60%) Gaps:16/308 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PEAMNDADRLVENLRHVPVRLP------RELEVRQLCRSLSDLLVGESNLLSLQSPQIVCGDIHG 65
            |:.:| .|.:::.|..|....|      .|.|:|.||....::.:.:..||.|::|..:|||:||
Zfish     4 PDKLN-IDSIIQRLLEVKGSRPGKNVQLTESEIRGLCLKSREIFLSQPILLELEAPLKICGDVHG 67

  Fly    66 QFEDLLHLLELGGSVQEHRYLFLGDLVDRGKNSVETFLLLAALKVRHPAQVSLLRGNHECRSATR 130
            |:.|||.|.|.||...|..||||||.|||||.|:||..||.|.||::|....||||||||.|..|
Zfish    68 QYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKVKYPENFFLLRGNHECASINR 132

  Fly   131 SYGFYEECLSRYGSANVWRMCCRVFDLLPLAAIIDGNILCVHGGLSPDMQRLDDLRSLDRCHEIP 195
            .||||:||..|| :..:|:.....|:.||:|||:|..|.|.|||||||:|.::.:|.:.|..::|
Zfish   133 IYGFYDECKRRY-NIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLQSMEQVRRVMRPTDVP 196

  Fly   196 ESGIIADLLWSDP-QEAPGWAASPRGHGKLFGGDVVEEFTRANGISLICRAHQLAQDGFRWHFGQ 259
            :.|::.||||:|| ::..||..:.||....||.|||.:|...:.:.|||||||:.:||:.:...:
Zfish   197 DQGLLCDLLWADPDKDVLGWGENDRGVSFTFGADVVAKFLHKHDMDLICRAHQVVEDGYEFFAKR 261

  Fly   260 LLVTIWSAPNYCYRCGNKAAILRLNAAGDYDFKVFEAQALHSKPQPRK 307
            .|||::||||||....|..|::.::......|::.       ||..:|
Zfish   262 QLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQIL-------KPADKK 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 126/301 (42%)
MPP_superfamily 12..296 CDD:301300 124/290 (43%)
ppp1caaNP_999976.1 MPP_PP1_PPKL 8..298 CDD:277359 125/298 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.