DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and rdgC

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_536738.3 Gene:rdgC / 40224 FlyBaseID:FBgn0265959 Length:746 Species:Drosophila melanogaster


Alignment Length:324 Identity:106/324 - (32%)
Similarity:154/324 - (47%) Gaps:52/324 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MNDADRLVENLRHV-------PVRL-------------------PR--ELEVRQLCRSLSDLLVG 46
            ::|.|.|||....:       |:|.                   |:  .|.:|:..:||.. |..
  Fly   163 LDDKDDLVEEFGDIVNAKIELPIRKNHIDLLIDVFRKKRGNRLHPKYVALILREAAKSLKQ-LPN 226

  Fly    47 ESNLLSLQSPQI-VCGDIHGQFEDLLHLLELGG-SVQEHRYLFLGDLVDRGKNSVETFLLLAALK 109
            .|.:.:..|.|: ||||:||:.:|||.:|...| ....:.|:|.||.|||||..:|..|||.:|.
  Fly   227 ISPVSTAVSQQVTVCGDLHGKLDDLLVVLHKNGLPSSSNPYVFNGDFVDRGKRGLEVLLLLLSLY 291

  Fly   110 VRHPAQVSLLRGNHECRSATRSYGFYEECLSRY--GSANVWRMCCRVFDLLPLAAIIDGNILCVH 172
            :..|..|.|.|||||.......|||..|..|:|  ....:......|:..|||.::::..:|.||
  Fly   292 LAFPNAVFLNRGNHEDSVMNARYGFIREVESKYPRNHKRILAFIDEVYRWLPLGSVLNSRVLIVH 356

  Fly   173 GGLSPDMQRLDDLRSLDRCHEI---------------PESGIIADLLWSDPQEAPGWAASP-RGH 221
            ||.| |...||.::|:||...:               .|...|.|::|||||...|...:. ||.
  Fly   357 GGFS-DSTSLDLIKSIDRGKYVSILRPPLTDGEPLDKTEWQQIFDIMWSDPQATMGCVPNTLRGA 420

  Fly   222 GKLFGGDVVEEFTRANGISLICRAHQLAQDGFRWHFGQLLVTIWSAPNYCYRCG-NKAAILRLN 284
            |..||.||.:.|.:.:.:|.:.|:|:...:|..:.....::||:||.|| |..| ||.|.:|||
  Fly   421 GVWFGPDVTDNFLQRHRLSYVIRSHECKPNGHEFMHDNKIITIFSASNY-YAIGSNKGAYIRLN 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 106/322 (33%)
MPP_superfamily 12..296 CDD:301300 106/322 (33%)
rdgCNP_536738.3 IQ 89..111 CDD:197470
MPP_RdgC 184..494 CDD:277364 101/303 (33%)
EFh 616..681 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438797
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.