DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and ppp4c

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_988943.1 Gene:ppp4c / 394540 XenbaseID:XB-GENE-970535 Length:307 Species:Xenopus tropicalis


Alignment Length:298 Identity:166/298 - (55%)
Similarity:209/298 - (70%) Gaps:2/298 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MNDADRLVENLRHVPVRLPRELEVRQLCRSLSDLLVGESNLLSLQSPQIVCGDIHGQFEDLLHLL 74
            ::|.||.:|.||.  ..|.:|.||:.||....::||.|||:..:.||..|||||||||.||..|.
 Frog     4 ISDLDRQIEQLRR--CELIKESEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFYDLKELF 66

  Fly    75 ELGGSVQEHRYLFLGDLVDRGKNSVETFLLLAALKVRHPAQVSLLRGNHECRSATRSYGFYEECL 139
            .:||.|.|..|||:||.||||..||||||||.|||||:|.:::|:|||||.|..|:.||||:|||
 Frog    67 RVGGDVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECL 131

  Fly   140 SRYGSANVWRMCCRVFDLLPLAAIIDGNILCVHGGLSPDMQRLDDLRSLDRCHEIPESGIIADLL 204
            .:|||..|||.|..:||.|.|:|||||.|.||||||||.:|.||.:|::||..|:|..|.:.|||
 Frog   132 RKYGSVTVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQTLDQIRTIDRKQEVPHDGPMCDLL 196

  Fly   205 WSDPQEAPGWAASPRGHGKLFGGDVVEEFTRANGISLICRAHQLAQDGFRWHFGQLLVTIWSAPN 269
            ||||::..||..||||.|.|||.|||.:|..||.|.:|||||||..:|::|||.:.::|:|||||
 Frog   197 WSDPEDTTGWGVSPRGAGYLFGSDVVAQFNAANNIDMICRAHQLVMEGYKWHFNETVLTVWSAPN 261

  Fly   270 YCYRCGNKAAILRLNAAGDYDFKVFEAQALHSKPQPRK 307
            |||||||.||||.|:.....:|.:|||....::..|.|
 Frog   262 YCYRCGNVAAILELDEHLQKEFIIFEAAPQETRGIPSK 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 165/294 (56%)
MPP_superfamily 12..296 CDD:301300 162/283 (57%)
ppp4cNP_988943.1 MPP_PP2A_PP4_PP6 6..290 CDD:277360 164/285 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D349967at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45619
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.